(data stored in ACNUC7421 zone)

EMBL: CP000283.PE294

CP000283.PE294       Location/Qualifiers
FT   CDS_pept        339389..340444
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0296"
FT                   /product="tyrosine recombinase XerD subunit"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0296"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37534"
FT                   /db_xref="GOA:Q13EF5"
FT                   /db_xref="InterPro:IPR002104"
FT                   /db_xref="InterPro:IPR004107"
FT                   /db_xref="InterPro:IPR010998"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR011932"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="InterPro:IPR023009"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF5"
FT                   /protein_id="ABE37534.1"
FT                   /translation="MRRPRSNPSSSVQSSVQALAAEPANRETAPLRPASYSDAGLSELF
FT                   LDMIAAEQGASANTIDAYRRDLADLSHYLTRSRKSIASADTEALRGYLADLDARGFKSS
FT                   SVARRLSALRHLFRFLLSERIRVDDPAAILSGPKRGRGLPKVLSIADVDRLLGYARQQA
FT                   EAADGAGGVRAARLYCLLEVLYATGLRVSELVSLPSSAARGDARMIVVRGKGDKERLVP
FT                   LNHSAKQAMTRYLATAAAAEKAAATATKAGSKGSKWLFPSFGESGHLTRQHFARDLKDL
FT                   AGRAGLSPRLVSPHVLRHAFASHLLHNGADLRIVQTLLGHSDISTTQIYTHVVEDRLKS
FT                   LVRDLHPLAEG"
     atgcgaagac cgcgaagcaa cccaagttcc tccgttcagt cgtcagtcca ggctttggcg        60
     gccgagcccg ccaaccggga gaccgcgccg ctgcggccgg cctcctattc ggacgcaggg       120
     ctgagcgagc tgttcctcga catgatcgcc gccgagcaag gcgcgtccgc caacaccatc       180
     gatgcctatc ggcgcgacct cgccgacctg tcgcattatt tgacccgaag ccgcaaaagc       240
     atcgcctccg ccgacaccga agcgctgcgc ggttatctgg ccgatctgga tgcgcgcggc       300
     ttcaaatcgt caagcgtggc gcggcggctg tcggcgctgc gacatctgtt ccgtttcctg       360
     ttgagcgagc ggatcagggt cgacgatccg gccgcgatcc tgtccggacc gaaacgcggg       420
     cgcggcctgc cgaaagtgct gtcgatcgcc gatgtcgatc gtctgctcgg ctatgcgcgg       480
     cagcaggccg aggccgcgga cggtgctggc ggcgtgcgcg ccgcgcgact gtattgcctg       540
     ctcgaggtgc tgtacgcgac cgggctgcgc gtctccgaac tcgtgtcgct gccctcgtcg       600
     gcggcgcggg gcgacgcgcg gatgatcgtg gtccgcggca agggcgacaa ggagcggctg       660
     gtgccgctca atcacagcgc gaagcaggcg atgacgcgct atctggctac cgcagctgca       720
     gccgaaaagg ccgcagcgac cgccaccaag gccggttcca aaggctcgaa atggctgttc       780
     ccgtctttcg gcgagagcgg gcatctgacc cggcagcatt tcgcgcgcga tctcaaggat       840
     ctggccggac gcgcggggct ttcgccgcga ctggtcagtc cgcacgtgct gcggcacgcc       900
     ttcgccagcc atctgctgca taacggcgcc gatctgcgga tcgtgcagac cctgctcggc       960
     catagcgaca tttccaccac gcagatctac acccatgtgg tcgaggatcg tctgaagagc      1020
     ctggtgcgcg acctgcaccc gctggcggaa ggctga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page