(data stored in ACNUC7421 zone)

EMBL: CP000283.PE295

CP000283.PE295       Location/Qualifiers
FT   CDS_pept        340595..341569
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0297"
FT                   /product="acetyl-coenzyme A carboxylase carboxyl
FT                   transferase subunit alpha"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0297"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37535"
FT                   /db_xref="GOA:Q13EF4"
FT                   /db_xref="InterPro:IPR001095"
FT                   /db_xref="InterPro:IPR011763"
FT                   /db_xref="InterPro:IPR029045"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EF4"
FT                   /protein_id="ABE37535.1"
FT                   /translation="MSLVMSEPMRSYLDFEKPVAELDSKIDELRTLAASGSDIHEEVSR
FT                   IEEKAAQALNELYAALTPWQKTQVARHPQRPHCVDYIQGLITEFTPLAGDRKFGEDEAL
FT                   IGGFGRFRGESICVLGQEKGSSTETRLKHNFGMARPEGYRKAVRLMEMADRFGIPVLSL
FT                   VDTAGAYPGIGAEERGQAEAIARSTDACLQLGVPNVAVVIGEGGSGGAIAIATANKVLM
FT                   LEHAIYSVISPEAASSILWRDGTKAQEAANSMKITAQDLLRFGVIDQILAEPKGGAHRD
FT                   PEAMIATTGDAIAAAFAELNGLDSSTVRNKRRQKFLEIGRKLG"
     atgtccctgg tcatgtcaga gcccatgcgc agctatctcg atttcgaaaa gccggtcgcg        60
     gaactcgatt ccaagattga cgagttgcgc acgctggcgg cgtccggcag cgacatccac       120
     gaggaagtct cgcgcatcga ggaaaaggcc gcgcaagcgc tgaacgagct ctacgcggcg       180
     ctgaccccgt ggcagaaaac ccaggtcgcg cggcatccgc agcggccgca ttgcgtcgac       240
     tacatccaag gactgatcac cgaattcact cctctggccg gcgaccgcaa gttcggcgag       300
     gacgaggcgc tgatcggcgg gttcggccga ttccgcggcg agagcatctg cgttctcggc       360
     caggagaagg gctcctcgac cgagacccgc ctcaagcaca atttcggcat ggcgcgtccc       420
     gagggctatc gcaaggcggt ccggctgatg gaaatggccg accgcttcgg catcccggtg       480
     ctgtcgctgg tcgacaccgc cggcgcctat ccgggcatcg gcgccgagga gcgcggccag       540
     gccgaggcga tcgcgcgctc gaccgacgcc tgcctgcagc tcggcgttcc caatgtcgcc       600
     gtggtgatcg gcgaaggcgg ctccggcggc gcgatcgcga ttgccaccgc caacaaggtg       660
     ctgatgctcg agcatgcgat ctacagcgtg atctccccgg aggccgcctc ctcgatcctg       720
     tggcgggacg gcaccaaggc gcaggaagcc gccaattcga tgaagatcac cgcgcaggac       780
     ctgctgaggt tcggtgtgat cgaccagatc ctggccgagc cgaagggcgg cgcccaccgc       840
     gaccctgagg caatgatcgc gaccaccggc gacgccatcg cggcggcctt cgccgaactc       900
     aacggcctcg attccagcac ggtccgcaac aagcgccggc agaaattcct cgagatcggc       960
     cgcaagctgg gctga                                                        975
//

If you have problems or comments...

PBIL Back to PBIL home page