(data stored in ACNUC7421 zone)

EMBL: CP000283.PE3

CP000283.PE3         Location/Qualifiers
FT   CDS_pept        3622..4758
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0003"
FT                   /product="DNA replication and repair protein RecF"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0003"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37243"
FT                   /db_xref="GOA:Q13F96"
FT                   /db_xref="InterPro:IPR001238"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR018078"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR042174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F96"
FT                   /protein_id="ABE37243.1"
FT                   /translation="MTASRITRLTLTHFRNYRAAALHTRGERVVLVGANGAGKTNCLEA
FT                   ISFLSPGRGLRRATLDDVSDHQGDGSWAVSAEVEGALGLATLGTGIDPPRADAATTRRC
FT                   RIDREPVGSATAFGDHLRMVWLTPAMDGLFMGAASERRRFFDRLVLAIDSQHSSRVSAL
FT                   DRSLRSRNRLLEERNADRHWLDAIERETAELAVAVAAMRGQTAARLAAMLDARGAASAF
FT                   PSAKIMLDGWMESALLTEPATAVEDRYRAILRDGRLRDAAAGRTLDGPHLTDLQVIYAP
FT                   KAMPARDASTGEQKALLIGLVLAHAQLVSEITGITPLLLLDEVVAHLDPARRRALFAEL
FT                   ERLGAQVWMTGADPAGFAEIGPDAEIFTVESGRIAPQK"
     atgaccgcat cccgcatcac ccggctgacg ctgacgcact tccgcaatta tcgggcggcg        60
     gcgttgcata cgcgtggcga acgggtggtg ctggtgggcg cgaacggcgc gggcaagacc       120
     aattgtctcg aggcgatctc gtttctgtcg cccggccgcg gcctgcgccg cgccacgctc       180
     gacgacgtct ccgaccatca gggcgacggc tcctgggcgg tgtcggccga ggtcgagggc       240
     gcgctcggcc tcgccacgct cggcaccggg atcgacccac cgcgcgccga cgccgccacg       300
     acgcggcgct gccggatcga ccgcgagccg gtcggctccg ccaccgcctt cggcgatcat       360
     ctgcgcatgg tgtggctgac gcctgcgatg gacggactgt tcatgggcgc ggcgtcggaa       420
     cggcggcggt ttttcgatcg cctggtgctg gcgatcgaca gccagcattc cagccgggtc       480
     tcggcgctcg accgcagcct gcgctcgcgc aaccggctgc tggaggaacg caacgcggac       540
     cgccactggc tcgacgcgat cgagcgcgaa accgccgaac tcgccgtcgc ggtcgcggcg       600
     atgcgcggcc agaccgcggc gcggctcgcc gcgatgctcg acgcccgcgg cgcggcgtcg       660
     gcgtttccgt cggcgaagat catgctcgac ggctggatgg aaagcgcgct gctgaccgag       720
     ccggcgaccg cggtcgagga tcgctaccgc gcgatcctgc gcgatggccg cctgcgcgac       780
     gccgccgctg gccgtaccct cgacggcccg catctcaccg atctccaggt gatctacgcg       840
     ccgaaggcga tgccggcgcg cgacgcctcc accggcgagc agaaggcgct gctgatcggg       900
     ctggtgctcg cccatgcgca gctcgtctcc gagatcaccg gcatcacgcc gctgctgctg       960
     ctcgacgagg tggtggcgca tctcgacccc gcccgccgcc gcgcgttgtt tgcggaactc      1020
     gagcggcttg gcgcgcaggt ctggatgacc ggcgccgatc cggcgggctt cgccgagatc      1080
     ggccccgacg ccgagatttt caccgtcgag tcgggccgga tcgcgccgca aaaatga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page