(data stored in ACNUC7421 zone)

EMBL: CP000283.PE303

CP000283.PE303       Location/Qualifiers
FT   CDS_pept        complement(353514..354239)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0305"
FT                   /product="3-oxoacyl-[acyl-carrier-protein] reductase"
FT                   /EC_number="1.1.1.100"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0305"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37543"
FT                   /db_xref="GOA:Q13EE6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR011283"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE6"
FT                   /protein_id="ABE37543.1"
FT                   /translation="MARVALVTGGTRGIGAAISKALKAAGYAVAASYAGNDSAAEKFKS
FT                   ETGIPVYKWDVSSFEACAAGVKQVEADLGPVDILVNNAGITRDGAFHKMTLEQWNAVIN
FT                   TNLGSLFNMTRQVIEGMRARKFGRIVNISSVNGQKGQFGQVNYSAAKAGDIGFTKALAL
FT                   ENARGGITVNAICPGYINTEMVQAVPKEVLEKAILPLIPCNRLGEADEIARAVVFLAAE
FT                   DSGFITGSTLSINGGQVMT"
     atggcgcgtg tagcattggt gacaggggga acgcgcggaa tcggtgcggc aatcagtaag        60
     gcgctgaagg cggcaggcta tgcggtcgca gcgtcctatg cgggcaatga ttcggcagcg       120
     gaaaaattca agagcgagac gggtatcccg gtatacaagt gggatgtgag ttcgttcgag       180
     gcctgtgcgg cgggcgtgaa acaggtcgag gccgatctcg gaccggtcga cattctcgtc       240
     aacaatgccg gcatcacccg tgacggcgca tttcacaaga tgacgctcga acagtggaac       300
     gcggtgatca acaccaatct cggttcgctg ttcaacatga cgcgccaagt gatcgagggg       360
     atgcgcgcgc gcaagttcgg ccgcatcgtc aacatctcgt cggtcaacgg ccagaagggc       420
     cagttcggcc aggtcaatta ttccgcggcg aaagccggcg acatcggctt caccaaagcg       480
     cttgcgctgg aaaacgcgcg cggcggcatc accgtcaatg cgatctgccc cggttacatc       540
     aacaccgaaa tggtgcaggc ggtgccgaaa gaagtgttgg agaaggcgat cctgccgctg       600
     attccgtgca accggctcgg cgaggctgac gagatcgcac gcgcggtggt gttcctcgcc       660
     gccgaggatt ccggcttcat caccggttcg acgctgtcga tcaatggcgg ccaggtgatg       720
     acctga                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page