(data stored in ACNUC7421 zone)

EMBL: CP000283.PE308

CP000283.PE308       Location/Qualifiers
FT   CDS_pept        complement(358756..359406)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0310"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0310"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37548"
FT                   /db_xref="GOA:Q13EE1"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EE1"
FT                   /protein_id="ABE37548.1"
FT                   /translation="MSIIGFPLLLIPLAICNIVVFLMPGVGFDAPLTRIPLPSGTIWTI
FT                   SAGEMLVALGVLMLLFEVIKAARPGAKYLTDHLLSLLVLGGTVAEFVMLPQFGNATVFL
FT                   LATLMLVDFLAGIALRHQPQPRTAGHARSRSVAKVDLPQQEPAVAAAPAAETPVAPFPT
FT                   ATAASISAASIAEAVLLDRPQPVASPKASASSPRIQSPGLQPADAAAGVQPPR"
     atgtcgatta tcggttttcc gctgctgctg atcccgctcg cgatctgcaa catcgtcgtt        60
     tttctgatgc cgggcgtcgg tttcgacgcg cctctcaccc gcatcccatt gccctcgggc       120
     acaatctgga cgatcagcgc cggcgagatg ctggtggcgc tcggcgtcct gatgctgctg       180
     ttcgaagtga tcaaggcggc ccgccccggc gccaaatacc tcaccgacca tctgctgtcg       240
     ctgctggtgc tcggcggcac ggttgcggaa ttcgtgatgc tgccgcagtt cggcaacgcc       300
     acggtgttcc tgctggcgac cttgatgctg gtcgattttc tcgccggcat cgcactgcgt       360
     catcagccgc agccgcgcac ggccggccat gcgcgttcga ggtccgttgc caaggtcgac       420
     ctgccgcagc aagagcctgc ggttgccgct gctcccgccg ctgaaactcc cgtggcgccg       480
     tttccgaccg ccacagcggc ctcgatttcg gcggcctcga tcgccgaggc cgtgctgctc       540
     gatcgtcctc agccggtcgc aagcccgaaa gcctcggcat cgtcgccccg gattcagtct       600
     ccgggattgc agccggcaga cgccgccgcg ggcgttcagc cgccgcgctg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page