(data stored in ACNUC7421 zone)

EMBL: CP000283.PE312

CP000283.PE312       Location/Qualifiers
FT   CDS_pept        361795..362481
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0314"
FT                   /product="protein of unknown function DUF1345"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0314"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37552"
FT                   /db_xref="GOA:Q13ED7"
FT                   /db_xref="InterPro:IPR009781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13ED7"
FT                   /protein_id="ABE37552.1"
FT                   /translation="MSREAPDDPRLLRFRKLPRAVRVVVSRPRLFISVAVGVIAALLLP
FT                   ASLRPVTRALIGWDVSIVVYLALAFSMMARCDIDYIRRNAVLQDDGRFLILMVTATGAF
FT                   ASIAAIVAELGSGHRGAAELALATVTIALSWAAVHTTFALHYAHEYYRGAQVGGLQFPS
FT                   GDTHEDADYWDFVYFSFVIGMTAQVSDVGITDKTIRRTATAHGVVSFVFNTALVALMVN
FT                   IAAGAI"
     atgagccgcg aggcgccaga cgatccacgt ctgctgcgct tcaggaaact gccgcgcgcg        60
     gtccgggtgg tggtgtcccg gccgcgcctg ttcatttcgg ttgcggtcgg ggtcatcgcg       120
     gcgctgctgc tgccggcgtc actgcggccg gtgacgcggg cgctgatcgg ctgggacgtc       180
     tcgatcgtcg tgtatctggc gctcgctttc agcatgatgg cccgctgcga catcgactac       240
     atccgccgca atgcggtgct gcaggacgat ggccgtttcc tgatcctgat ggtgacggca       300
     accggcgcgt tcgccagcat cgccgcgatc gtcgccgaac tcggctccgg gcatcgcggc       360
     gccgcggagc tcgcgctcgc aacggtgacg atcgcgctgt cgtgggcggc ggtgcatacg       420
     accttcgcgt tgcactacgc acatgaatat tatcgcggcg cccaagtcgg cggtctgcag       480
     ttcccgagcg gcgacacgca cgaggacgcc gactattggg atttcgtgta cttctcgttc       540
     gtgatcggga tgaccgcgca ggtgtccgat gtcggcatca ccgacaagac catccgccgc       600
     accgcgaccg cccacggcgt ggtgtccttc gtcttcaaca ccgcgctggt tgcactgatg       660
     gtcaacatcg ccgccggcgc gatctga                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page