(data stored in ACNUC7421 zone)

EMBL: CP000283.PE32

CP000283.PE32        Location/Qualifiers
FT   CDS_pept        38941..39660
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0032"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0032"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37272"
FT                   /db_xref="InterPro:IPR027802"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F67"
FT                   /protein_id="ABE37272.1"
FT                   /translation="MDGQVEILERRSRGMEYPVNGAMAAFPDNVVNGREVLTRSGLVPA
FT                   SEYRLILVRNGRTRLIGTDDDVDLDKEHGGSFRAFLSDRDFGFTVDEVGQVWGTADMEV
FT                   DEFLRIWPQHPEHRWVLERDDEPDTVLTPGGVLSFGPKGVEHVVSRKDAHPDKVMVTVV
FT                   TTAGVYPAEGAKRYPRSTRISDVLNDAARKLDIRDSSTWIVTVAGRDVSPTLTFAQANL
FT                   TGTVELEWGPREGGGGA"
     atggacggac aggtcgaaat tttggagcgc cgctcccgcg gcatggaata tccggtaaac        60
     ggggccatgg ccgcgttccc ggacaacgtg gtgaacggcc gtgaggtctt gacccgttct       120
     gggttagttc cggccagcga atatcggttg atcctggtgc ggaacggccg gacccgtctt       180
     atcggcaccg acgacgacgt cgacctcgac aaggagcatg gaggttcgtt ccgggcgttc       240
     ttgtcggacc gcgacttcgg cttcaccgtc gacgaggtgg gacaggtctg gggtacggcc       300
     gatatggagg tcgacgaatt cctccgcatc tggccgcagc accccgaaca ccgttgggtg       360
     ctcgagcgcg acgacgaacc ggacacggtg ctcacgccgg gcggcgtcct gtcgttcggt       420
     cccaaaggtg tcgagcatgt cgtgtcgcgc aaggacgccc atccggacaa ggtgatggtc       480
     acggtggtca ccaccgccgg cgtctacccc gccgaaggcg ccaagcgtta cccgcggtcg       540
     acgcggatct ccgacgtgct caacgacgcc gcgcgcaagc tcgatatccg ggacagctcg       600
     acctggattg tcaccgtcgc cgggcgcgac gtgagcccca ccctgacgtt cgcccaggcg       660
     aacttgaccg gcaccgtgga gctcgagtgg ggaccgcgcg agggaggcgg cggtgcttga       720
//

If you have problems or comments...

PBIL Back to PBIL home page