(data stored in ACNUC7421 zone)

EMBL: CP000283.PE324

CP000283.PE324       Location/Qualifiers
FT   CDS_pept        379721..380266
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0326"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0326"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37564"
FT                   /db_xref="GOA:Q13EC5"
FT                   /db_xref="InterPro:IPR003752"
FT                   /db_xref="InterPro:IPR023380"
FT                   /db_xref="InterPro:IPR024199"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC5"
FT                   /protein_id="ABE37564.1"
FT                   /translation="MTANLLHHTGLGFRPARAARIARNVALTYAVIAAAALGAAWFFQL
FT                   ALDLTPCPLCLEQRYAYYAAIPLAGLIALGAWREAPISLLIAGLAVLAVLALGNAGLGA
FT                   YHAGVEWKFWTGPTDCAGPVLDFGKAGSLLDQLDKVKVMRCDEVQWRFLGLSLAGYNVL
FT                   VSLALAALAAWGIARIRR"
     gtgaccgcca acctcctcca ccacaccggc ctcggcttcc ggccggcccg cgcggcgcgc        60
     atcgcgcgca acgtggcgtt gacctatgcg gtcatcgccg ccgcggcgct cggggccgcg       120
     tggtttttcc aactggcgct cgacctcacg ccctgcccgc tctgcctcga gcagcgctac       180
     gcatattatg cggcgatccc gctcgccggc ctgatcgcgc tcggcgcctg gcgcgaagcc       240
     ccgatctcgc ttctgatcgc cggcctggcg gtgctggcgg tgctggcgct cggcaatgcc       300
     gggctcggcg cctaccatgc cggcgtcgaa tggaaattct ggaccggccc gaccgattgc       360
     gccggcccgg tgctcgattt cggcaaggct ggcagcctgc tcgaccagct cgacaaagtg       420
     aaggtgatgc gctgcgacga ggttcaatgg cggtttctcg gcctgtcgct cgccggctac       480
     aatgttctgg tctcgcttgc cctcgccgca ctcgccgctt ggggaatcgc ccggatcagg       540
     cgctga                                                                  546
//

If you have problems or comments...

PBIL Back to PBIL home page