(data stored in ACNUC7421 zone)

EMBL: CP000283.PE325

CP000283.PE325       Location/Qualifiers
FT   CDS_pept        380435..381637
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0327"
FT                   /product="signal transduction histidine kinase"
FT                   /EC_number="2.7.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0327"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37565"
FT                   /db_xref="GOA:Q13EC4"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR003594"
FT                   /db_xref="InterPro:IPR005467"
FT                   /db_xref="InterPro:IPR011495"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EC4"
FT                   /protein_id="ABE37565.1"
FT                   /translation="MPSEHRPAPATAPEASLNRLEELPYRRRQQALLREFGTAALQTRD
FT                   FRQILQQAVDLSARGLGCSFAKVLEYVAVEKRLIVRAGIGWPAGTVDHVSLGADIESPA
FT                   GFAFQTGQSVVSNHLQDETRFRTPKLLADHGIKRAINVLIRRGGEGDTAFGVLEADSPD
FT                   PGQFDDADADFLAGFAGLLGIAIERQHADAKLQEALDHEALLTREMSHRVKNSLTSVVG
FT                   LLRVQARGSESADVKNALEDAAMRVASIAGVHDHLWRGSKVGFVDLSDFVSHLCETLQG
FT                   SAPEHVIQCRSDDIILSADKAIPLGLLVNELVTNAIKYAYVDGHGVIRLDAREINGHLL
FT                   VEISDEGAGLPDGFDINQPRKSLGFRVILGLVRQLLGELTISKNLPRGALFTIKFPVDP
FT                   P"
     atgcccagcg aacacaggcc ggcccccgcg accgccccgg aggcttcgct caatcgcctc        60
     gaagaacttc cgtatcgccg ccgccaacaa gcgcttctcc gggaattcgg gacggctgcg       120
     ttgcagacgc gcgatttccg gcaaattctt cagcaggcgg tcgaccttag cgcccgcggt       180
     ctgggatgct cattcgcgaa ggttctggag tacgtcgcgg tcgaaaagcg cttgatcgta       240
     cgggcaggaa tcggctggcc ggccggcaca gtggaccatg tttcgctcgg cgccgacatc       300
     gaatcgcctg caggctttgc ctttcaaacc gggcaatcgg tagtctccaa tcacctacag       360
     gacgagacgc ggttccgaac gccgaaactt ctggccgacc atggtatcaa acgcgccatc       420
     aatgtcctga tcaggcgggg tggcgagggc gacacggcct tcggtgttct cgaagcggac       480
     agtccggatc ctggacagtt cgacgacgcc gatgcggatt ttctggccgg cttcgcgggc       540
     ctgctgggca tcgccatcga acgtcaacac gcggacgcta aacttcagga agcgctcgat       600
     catgaggccc tgctgacgcg cgagatgagt catcgcgtca agaacagcct gacctcggtc       660
     gtcggcctgc tacgtgtcca ggcacggggc tcggagtccg cggacgtgaa gaacgcattg       720
     gaagacgccg ccatgcgggt tgcttcgatc gcgggagttc acgatcacct ctggcgcggc       780
     agcaaggtcg gcttcgtcga tctgtccgac ttcgtcagtc atctctgcga gacgcttcag       840
     ggttcggcgc cggaacatgt cattcaatgt cgttccgacg acatcatcct gtctgccgac       900
     aaggccattc ctttaggcct gctggtcaac gaacttgtga ccaatgccat caaatatgcc       960
     tatgtcgatg gacatggtgt gatcaggttg gacgcccggg aaatcaacgg gcatctgctg      1020
     gtcgagatat ccgacgaagg cgccggcctg cccgacgggt tcgacatcaa tcagccgcgc      1080
     aagagcctcg gcttccgtgt catcctcggt ctggtccggc agctgttggg cgagctgacg      1140
     atctcgaaga acttaccgag gggagcattg ttcacgatca agtttcccgt tgacccgccc      1200
     tag                                                                    1203
//

If you have problems or comments...

PBIL Back to PBIL home page