(data stored in ACNUC7421 zone)

EMBL: CP000283.PE33

CP000283.PE33        Location/Qualifiers
FT   CDS_pept        39653..40090
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0033"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0033"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37273"
FT                   /db_xref="InterPro:IPR025873"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F66"
FT                   /protein_id="ABE37273.1"
FT                   /translation="MLEALSKATFDRDIGRIDPRSVRMYDWAIVQANYPVFDVIFNHAQ
FT                   VAPLRLRLVCDDWDEIPPSIELLNKEGQPLATAPPNVGNVFNGSTHPNTGRPFVCMRGA
FT                   REYHTHGSHTSDLWDNYRGQSGMDLGGIVVQLWRAWKRSVG"
     gtgcttgagg cgctctccaa ggcgacattc gatcgcgaca tcggacggat cgatcctcgg        60
     tccgtccgga tgtacgactg ggcgatcgtc caggcgaact atcccgtctt cgacgtcatc       120
     ttcaaccacg cccaggtcgc gccgctgcgg ctgcgattgg tgtgcgacga ttgggacgag       180
     atcccgccgt ccatcgagtt gctgaacaag gagggacagc ccctcgctac ggcgccaccg       240
     aacgtgggca acgtattcaa cggcagcacg caccccaaca ccgggcggcc gttcgtctgc       300
     atgcgcggcg cgcgtgagta ccacacccac ggaagtcaca cgtctgacct gtgggacaac       360
     taccgcggac aatccggcat ggatctgggc gggatcgtgg ttcagctttg gcgagcttgg       420
     aagaggagcg tcggatga                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page