(data stored in ACNUC7421 zone)

EMBL: CP000283.PE332

CP000283.PE332       Location/Qualifiers
FT   CDS_pept        386266..386733
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0334"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0334"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37572"
FT                   /db_xref="GOA:Q13EB7"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB7"
FT                   /protein_id="ABE37572.1"
FT                   /translation="MTDASALPTSAAATHRVHGSAPRRAIALLAAVSAIAIALLVSSPE
FT                   ASTLAVASSDAELVMLLRFMAAVKALLALVALGVSVWRLGFPASPVLKVAYTLAPALMC
FT                   AAPVVIWQMADVAFGAGLFHAGFVLLLLALYADRGQAVELAKSAALKLRRA"
     atgaccgacg cttcagcctt gccgacgtcc gccgctgcta cgcatcgcgt acacggatcg        60
     gcgccgcgcc gcgccatcgc gcttctcgct gcggtctcgg cgatcgccat cgcgctgctg       120
     gtttcctcgc cagaagccag cacccttgcc gtcgcatcat ccgacgccga actggtgatg       180
     ctgctgcgct tcatggccgc ggtgaaagcc ctgctcgctt tggtcgcgct cggcgtctcg       240
     gtgtggcgtc tcggctttcc ggcgtcgccg gtgctgaagg tcgcctacac gctcgcgccg       300
     gcgctgatgt gcgccgcgcc ggtcgtgatc tggcagatgg cggatgtggc cttcggcgcc       360
     gggttgtttc atgccggctt cgtgctgctt ctgctggcgc tgtatgccga tcgcggacag       420
     gccgtcgaac tggcgaagtc cgccgcgctg aagctgcggc gagcttag                    468
//

If you have problems or comments...

PBIL Back to PBIL home page