(data stored in ACNUC7421 zone)

EMBL: CP000283.PE339

CP000283.PE339       Location/Qualifiers
FT   CDS_pept        395002..395274
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0341"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0341"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37579"
FT                   /db_xref="GOA:Q13EB0"
FT                   /db_xref="UniProtKB/TrEMBL:Q13EB0"
FT                   /protein_id="ABE37579.1"
FT                   /translation="MPERDLDHPAPKKSRRRRSTAPRRRSRTDSRGCDVVVVIQRATCF
FT                   VNRSLTTKQEDTMSVLRKLNGMEAAVIGGALLMTLAPLVPYALLG"
     gtgccagagc gcgatttgga tcaccccgcg ccgaaaaaaa gccgccgacg ccgatcgacg        60
     gcgccgcggc gtcgatcacg caccgactca cgcggctgtg atgtcgtggt ggtgatccag       120
     cgcgcgacct gcttcgtaaa caggtcacta acaaccaaac aggaggatac gatgtcggtg       180
     cttcgcaagt tgaacggaat ggaagctgcc gtgatcggcg gcgctctgct gatgaccctc       240
     gccccgctgg tgccctacgc actgctcggc tga                                    273
//

If you have problems or comments...

PBIL Back to PBIL home page