(data stored in ACNUC7421 zone)

EMBL: CP000283.PE34

CP000283.PE34        Location/Qualifiers
FT   CDS_pept        40087..40557
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0034"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0034"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37274"
FT                   /db_xref="InterPro:IPR028090"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F65"
FT                   /protein_id="ABE37274.1"
FT                   /translation="MSSIICTRSVLERTISIIRRDGNRGEERVALWLATAAQRSPAAIV
FT                   EVYEPEQVVEVDSFYIPPASMRALMNHLRSTRRRIAAQIHTHPGRAYHSDADAKWAIIR
FT                   HSGALSLVLPHFANATTVENFLEEVMTYEYSPAGEWIHCPNVGAGARVVVTA"
     atgagctcca tcatctgcac ccgtagcgtc ctggaaagga cgatctccat cattcgacgc        60
     gacggcaacc gcggcgaaga gcgggtcgcg ctgtggctcg cgaccgcagc ccagcgctcg       120
     ccagcagcca tcgtcgaggt gtacgaacct gagcaggtgg tcgaggtcga ctccttctac       180
     atcccgcccg cctcgatgcg cgcgctgatg aaccatctca ggtcgacgcg tcggcgtatc       240
     gccgcgcaga tccacactca ccccggccgc gcctaccact ccgacgccga cgccaagtgg       300
     gcgatcatcc gtcactccgg tgcgctctcg cttgtgttgc ctcactttgc gaacgccacg       360
     accgtcgaga atttcctcga agaggtcatg acctacgaat actcgccggc gggcgaatgg       420
     atccattgtc ccaacgtcgg cgccggcgcg cgtgtagtgg tgaccgcatg a                471
//

If you have problems or comments...

PBIL Back to PBIL home page