(data stored in ACNUC7421 zone)

EMBL: CP000283.PE356

CP000283.PE356       Location/Qualifiers
FT   CDS_pept        423299..424021
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0358"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0358"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37596"
FT                   /db_xref="GOA:Q13E93"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR023772"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E93"
FT                   /protein_id="ABE37596.1"
FT                   /translation="MPEPPARNRSNVSARIDVSLIAMTKNSADSARPRGLVQVRSSRAD
FT                   KQERTRRALLQAAIDIVGDEGYAAATVGKITSRAKVANGTFYNYFDSQQSIFDQLLPFL
FT                   GDRLTAHIKAQVDESLTGVARDRARFVAYFDFCRKNPAFLRVLNEAEVFAATAYRQHVV
FT                   AMYEGYLHALERSAAKHEITGYDREELPPVVFMLMGIRSYMTMLYQHNYVERSALSIEA
FT                   MADIYEKLLTLGLFNDRR"
     atgcccgagc cgccggccag aaaccgcagt aatgtgtccg cccgaatcga tgtaagcttg        60
     atcgcaatga cgaagaactc ggccgacagc gcgcgtcctc gcgggcttgt tcaggttaga       120
     tcctcacgcg cggacaaaca ggaacgaacg cggcgcgcgc tcctgcaagc cgcgatcgat       180
     attgtgggcg atgagggata tgcggcggcg actgtcggca agatcaccag ccgggccaaa       240
     gtggcgaacg gcaccttcta taactacttc gatagtcagc agagtatttt cgatcagctc       300
     ctgccctttt tgggcgaccg gttgaccgca catatcaagg cgcaggtgga cgagtcccta       360
     acgggcgtcg cgcgtgaccg cgcacgtttc gtcgcctatt tcgatttctg tcgtaagaat       420
     cccgcatttc ttcgtgtctt gaatgaagcg gaggtgttcg ccgcgaccgc ttaccgacag       480
     cacgtcgtgg cgatgtatga aggctatctt cacgcgctgg agcgcagcgc cgccaagcat       540
     gagatcacgg gttacgaccg tgaagaactg ccgcccgtgg tgttcatgct gatgggcatt       600
     cgaagctata tgaccatgct ctatcagcac aattacgtcg agcgttccgc gctctcgata       660
     gaagcaatgg ctgatatcta cgaaaagctc ttgaccctcg ggctcttcaa cgaccgacgt       720
     tag                                                                     723
//

If you have problems or comments...

PBIL Back to PBIL home page