(data stored in ACNUC7421 zone)

EMBL: CP000283.PE359

CP000283.PE359       Location/Qualifiers
FT   CDS_pept        complement(427197..427559)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0361"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0361"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37599"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E90"
FT                   /protein_id="ABE37599.1"
FT                   /translation="MGDIMGVLASGYTSAALQNPSRTPYKNVDEKLYEGTWSGTYSNTK
FT                   KFSITVSDVQGFRAQVRYQSEGSIKFQSVLIKDGSFRVGDTKFTLGANGSASIRTAVSD
FT                   PVTGQVNLVKGTAKLG"
     atgggtgaca tcatgggcgt tctggcgtcg ggctatacct cggccgcgct gcagaatccg        60
     tcgcggacgc cgtacaagaa tgtcgacgag aagctgtacg aaggcacctg gagcgggacc       120
     tattcgaaca ccaagaaatt ctcgatcacg gtgtcggatg tgcagggctt tcgcgcgcag       180
     gtccggtacc aaagcgaagg ctcgatcaag tttcagtccg tgctgatcaa ggacggttcg       240
     ttccgggtcg gcgacaccaa gttcacgctc ggcgccaacg gcagcgcctc gatccgcacc       300
     gcggtcagcg atccggtcac aggccaggtc aatctcgtca aaggcaccgc aaagctcggc       360
     tga                                                                     363
//

If you have problems or comments...

PBIL Back to PBIL home page