(data stored in ACNUC7421 zone)

EMBL: CP000283.PE362

CP000283.PE362       Location/Qualifiers
FT   CDS_pept        429057..429875
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0364"
FT                   /product="protein of unknown function DUF81"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0364"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37602"
FT                   /db_xref="GOA:Q13E87"
FT                   /db_xref="InterPro:IPR002781"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E87"
FT                   /protein_id="ABE37602.1"
FT                   /translation="MAITSADLITVASGGLVGFILALIGGGGSVLAVPLLVYVVGIRSP
FT                   HVAIGTSSIAVAISALANLLGHWAAGNVRWNCALVFSAAGIGGAFAGSFIAKQIDGQKL
FT                   LLLFGMLMVVIGVLMSRRQSGGGDPTIRLTIATAKTMLPKLIGTGFGVGALAGFFGIGG
FT                   GFLIVPGLILATGMPLTSAIGSSLVAVFAFGASTAASYALSGLIDWRLAGLFISGGLIG
FT                   GLIGIGAGKLIGAHDKVLRGVFSAVVVVVGLYVCYRGVAYFLVAQHPMSL"
     atggcaatca cctcggccga cctgatcacc gtcgcgagcg gcgggctggt cggtttcatc        60
     ctcgcgctga tcggcggcgg cggctcggtg ctcgcagtgc cgctgctggt ctatgtggtc       120
     ggaatccgct cgccgcatgt tgcgatcggc accagctcga tcgccgtcgc gatctcggcg       180
     ctcgccaatt tgctcggcca ctgggccgcg gggaatgtcc gctggaactg tgcgctggtg       240
     ttctctgcgg cagggatcgg cggcgcattc gccggttcgt tcatcgccaa gcagatcgac       300
     ggccagaaat tgctgctgct gttcggcatg ctgatggtcg tgatcggcgt gctgatgtca       360
     cgccggcaaa gcggcggcgg cgatccgacc atccgcctga cgatcgcgac ggcaaaaacc       420
     atgctgccga aactgatcgg caccggcttc ggcgtcgggg cgctcgccgg cttcttcggc       480
     atcggcggcg gcttcctgat cgtgccgggc ctgatcctcg ccaccgggat gccgctcact       540
     tccgcgatcg gcagctcgct ggtggcggtg ttcgcgttcg gcgcatcgac tgcggcgagc       600
     tacgcgctgt ccgggctgat cgactggcgg ctcgccggcc tgttcatcag cggcggtctc       660
     atcggcggac tgatcggcat cggcgccggc aagctgatcg gcgcacacga caaagtgctg       720
     cgcggggtgt tctcggcggt cgtggtcgtg gtcgggctgt atgtctgcta ccgcggcgtg       780
     gcctattttc tggtggcgca acacccgatg agcctctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page