(data stored in ACNUC7421 zone)

EMBL: CP000283.PE372

CP000283.PE372       Location/Qualifiers
FT   CDS_pept        440240..440926
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0374"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0374"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37612"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E77"
FT                   /protein_id="ABE37612.1"
FT                   /translation="MDPVLTEIPGRILDLAFGALSQANMHAVFSDAGNEHWDFISVTNT
FT                   AHAGELFLKAIIAKEHPLLIFKDLFSLDDNRTDSIELVNLIKRGKTHEFERLPQIIWAV
FT                   TGKRIPNPECYERLRRARNSIQHFCAPEDEDFRDLSLEFIYTIIDPLIFEHFESFAIEY
FT                   HEDHSAGDDYVVATLLRKQLRFSVPDDFDITEIRIRDEISASSQTYREWITGELNRIGR
FT                   LDLLNK"
     atggatcccg tcctgacgga gattcctggg agaattctag acttagcatt tggcgcattg        60
     tctcaggcca atatgcacgc agtgttttcc gacgctggga acgagcactg ggattttata       120
     tccgttacca atactgccca tgcaggcgag ctgtttctta aagcgatcat cgcgaaagaa       180
     catcctctcc tcattttcaa agaccttttc agcctcgacg acaatcgcac tgattcaatc       240
     gagctcgtta acctaattaa gcgggggaag acgcacgaat tcgaaaggct ccctcagata       300
     atttgggcag taacaggaaa acgcatccca aatccggaat gctacgaacg actgaggcgc       360
     gcacgaaatt caatccagca cttctgcgcc ccggaggacg aagactttcg ggatctctca       420
     ctcgagttca tttatacgat aattgatcct cttatttttg agcactttga gagttttgcg       480
     atcgagtatc acgaagatca ttcagcaggc gacgactacg tcgtagcgac tctgctgcgg       540
     aaacaactta gattttccgt tcccgatgac ttcgatatta cagagatacg cattcgggat       600
     gagatctcgg cttccagcca aacttaccgc gagtggatca cgggcgaatt gaaccgaatc       660
     gggcgacttg atttacttaa caagtaa                                           687
//

If you have problems or comments...

PBIL Back to PBIL home page