(data stored in ACNUC7421 zone)

EMBL: CP000283.PE373

CP000283.PE373       Location/Qualifiers
FT   CDS_pept        441249..441485
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0375"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0375"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37613"
FT                   /db_xref="InterPro:IPR021558"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E76"
FT                   /protein_id="ABE37613.1"
FT                   /translation="MPAQPKKPTPKSPRERMAARRERLRAEGLRPVQHWVPDLRDPKVL
FT                   ADIRREGAMMAKHPDNDAIDAWIEEVADLDAWS"
     atgcccgctc aacccaagaa gcccaccccc aaatccccgc gcgagcgcat ggcggcgcgg        60
     cgggagcggt tgcgggcgga ggggctgcgg cctgtgcagc attgggtgcc cgatctgcgt       120
     gatccgaagg tgctggccga tatccgccgc gaaggagcga tgatggcgaa gcaccccgac       180
     aacgacgcca tcgatgcttg gatcgaggaa gtcgcggacc tggacgcgtg gagctga          237
//

If you have problems or comments...

PBIL Back to PBIL home page