(data stored in ACNUC7421 zone)

EMBL: CP000283.PE38

CP000283.PE38        Location/Qualifiers
FT   CDS_pept        48319..49446
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0038"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0038"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37278"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F61"
FT                   /protein_id="ABE37278.1"
FT                   /translation="MLIYRFCFSAGGEQIAMARTKTLNSNGKKISKKNGPRYPTQVIDI
FT                   GFNFAGYPIFSATAAALLRKMHTQKVRPPQPDHISGMAPYSRIPFAETSFIIGHWFLET
FT                   ALNETAMFFVRRAYQQTKQFASETEAVKQIDDFFSLSVSSPVKKVEAYDKICGTQIAGK
FT                   ADLMEKIWTICAIRDLLYHHEANRYRGGKAPACVAKLFGYISDTPDQRSWIKAGWSPVL
FT                   GSKSAFDFVVQTVIDFTDTMSAELGHKHRFQTVDHLAKKPGIVSLCAEPGLVPPKETIK
FT                   SIQEKYTDPKTKAKVIAFDGTRRGTYYLFSKNKKYYVVHVTNRGRERTVPAWEILKIKN
FT                   ADRIGWIPIPWKGMDSELKRSVRERVSDIEIYRSA"
     ttgctaatat atcgattctg tttttcagca ggtggggagc agatcgccat ggcaagaaca        60
     aagacgctga actcaaacgg caaaaagatc tcgaagaaga acggacctcg ttatccaacg       120
     caagtaatag acatcggatt caatttcgca ggttatccaa ttttcagcgc aacagcggct       180
     gctctgctgc gaaaaatgca tactcaaaaa gtacggcccc cgcagccaga tcatatatct       240
     ggcatggcgc cttacagtcg catccctttc gctgaaactt ctttcattat tggccattgg       300
     tttttagaga cggccctcaa cgaaaccgcc atgttcttcg tgagacgagc ataccaacag       360
     acaaaacaat ttgcctcaga aacggaggca gtgaagcaga ttgacgactt cttttcgcta       420
     tctgtttcat cgccagtgaa gaaagtcgaa gcatacgaca agatttgcgg aacgcagatc       480
     gcaggcaagg ccgatctgat ggaaaagatt tggacgatct gcgcgatccg agatttgctg       540
     taccaccatg aagcgaaccg atatcgcgga ggcaaggcac cagcctgtgt tgcaaaactt       600
     ttcggctaca tctccgatac tccggaccaa agatcatgga tcaaagctgg ctggagccct       660
     gtgctaggtt caaaatcggc gttcgatttt gtcgtgcaga ctgtaatcga ttttaccgac       720
     acgatgtctg ccgaacttgg ccacaaacat cgcttccaga ccgtcgacca cttagccaaa       780
     aagccgggga tagtctccct atgcgccgaa cctggcctcg ttccaccgaa agagaccatt       840
     aagagcattc aggaaaaata tacggaccct aagacgaagg caaaagtcat agcattcgac       900
     ggaactagac gtgggacgta ctacctattc tcaaagaaca aaaagtatta tgtcgttcat       960
     gtcaccaata gaggacgcga acgcacggtc cctgcttggg aaattctgaa aataaaaaac      1020
     gctgatcgga ttggatggat cccaattccc tggaaaggga tggattcgga gctcaaaaga      1080
     agcgtaagag aaagggtgtc tgatatcgaa atttatcgtt cagcataa                   1128
//

If you have problems or comments...

PBIL Back to PBIL home page