(data stored in ACNUC7421 zone)

EMBL: CP000283.PE380

CP000283.PE380       Location/Qualifiers
FT   CDS_pept        449106..449621
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0382"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0382"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37620"
FT                   /db_xref="GOA:Q13E69"
FT                   /db_xref="InterPro:IPR016990"
FT                   /db_xref="InterPro:IPR019253"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E69"
FT                   /protein_id="ABE37620.1"
FT                   /translation="MALDTDLDPELAQPKLFSALLKPHRALSHKAFLVLMGVLGTISFA
FT                   VGVGFWTMGAWPVFGFFGLDLLAIYIAFRISFARGRASEEISITISELRVRRISHRGHV
FT                   AEWVLNPLWVRLEKIVHAEFGIEQLYLVSRGRRVSVASFLGAEEKASFANALTAALDAA
FT                   RRGPLVRH"
     atggcgttag acaccgatct tgatccggaa ttggcgcagc cgaaactgtt ttcggcgctg        60
     ctgaagccgc atcgcgcatt gagtcacaag gcttttttgg tgctgatggg agtcctcggc       120
     acgatcagct tcgccgtcgg cgtaggcttc tggacgatgg gcgcgtggcc ggtgttcggt       180
     ttcttcggcc tcgacctgct ggcgatctat atcgccttca ggatcagctt cgcccgtggc       240
     cgcgccagcg aggaaatctc gatcacgatc agcgagttac gggtccgtcg catttcgcat       300
     cgcggtcacg tggcggagtg ggtgctgaat ccgctctggg tccggctgga gaaaatcgtc       360
     cacgccgagt tcggcatcga gcagctttat ctggtctcgc gcggccgccg cgtcagcgtc       420
     gcgagttttc tcggagccga agaaaaagct agcttcgcca acgccttgac cgccgccttg       480
     gatgccgcgc ggcgcggccc gctggttcgg cattga                                 516
//

If you have problems or comments...

PBIL Back to PBIL home page