(data stored in ACNUC7421 zone)

EMBL: CP000283.PE384

CP000283.PE384       Location/Qualifiers
FT   CDS_pept        complement(453124..453435)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0386"
FT                   /product="protein of unknown function DUF1330"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0386"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37624"
FT                   /db_xref="InterPro:IPR010753"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E65"
FT                   /protein_id="ABE37624.1"
FT                   /translation="MAKGYWVARMDVHDLDGYKRDYVAHNGTVFAKYGARFLTRGGTYE
FT                   AHEGPARSRNVVIEFKDYATALACYHSPEYQALIKARSPFAQGEIVIVEGYDGPQPQG"
     atggccaagg gctactgggt tgcacggatg gatgtgcacg atctcgacgg ctacaagcgc        60
     gattatgttg cccacaacgg cacggtgttt gcgaaatacg gcgccaggtt cttgacccgc       120
     ggcggaacct acgaggcgca tgaagggccg gcgcgctcac gcaatgtcgt catcgagttc       180
     aaggactacg cgacagcgct cgcctgctac cactcaccgg agtaccaggc gctgatcaag       240
     gccaggtcgc cttttgcgca gggcgagatc gtcatcgtcg agggctatga cggcccgcag       300
     ccgcagggct ga                                                           312
//

If you have problems or comments...

PBIL Back to PBIL home page