(data stored in ACNUC7421 zone)

EMBL: CP000283.PE396

CP000283.PE396       Location/Qualifiers
FT   CDS_pept        complement(464836..466035)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0398"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0398"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37636"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E53"
FT                   /protein_id="ABE37636.1"
FT                   /translation="MAGLREPNTKSLRTTRRTAIGLILGTPLLGACSGVQQTLNNQFGQ
FT                   QPPPDAAQQQSQSVGTGRVKVGLVLPLSAAGNAGVAAQSMKNAAEMALAEFNNPDVQLL
FT                   VKDDAGNPQGAQSATQQALDEGAEIILGPLFAQSVPAAAQLTRARGISMIAFSTDSSVA
FT                   GRGVYLLSFLPESDVNRIIGYAASVGKRSYAALLPDNAYGGVVEAAFKQVVGTKGGRIA
FT                   AFEKYGADRAAAARTIAQALAGADSLLLADDGDALAGVSDALTAAGVDLRRLQLLGTGL
FT                   WDNPRVFATPALQGGLYAAPDPSGFRSFSGRYRARFGQDPVRTATLAYDAVALVAALAR
FT                   TQATRRFSSDVLTNPSGFAGIDGLFRFRADGSNERGLAVMRVATGGAQAVAGSPKSFGA
FT                   "
     atggcgggac tgcgcgagcc aaacacgaag tcgttgcgaa cgacacgccg aacggcgatc        60
     ggcctgatcc tcggcacgcc gttgctcggc gcctgctcgg gtgtgcagca gaccctcaac       120
     aaccagttcg gccagcagcc gccgccggat gcggcgcagc agcagtcgca atcggtcggc       180
     accggtcggg tcaaggtcgg cctggtgctg ccgctgtcgg cggcgggcaa tgccggcgtc       240
     gccgcgcaat cgatgaagaa cgccgccgag atggcgcttg ccgaattcaa caatcccgac       300
     gtccagttgc tggtgaagga cgacgccggc aatccgcagg gcgcgcaatc cgcgacccag       360
     caggcgctcg acgaaggcgc cgagatcatt ctcggcccgc tgttcgcgca atcggtgccc       420
     gccgcagccc agctgacccg cgcccgcggc atctcgatga tcgcgttttc gaccgattcg       480
     agcgtcgccg gccgcggcgt gtatctgctg agcttcctgc cggagtcgga cgtcaatcgg       540
     atcatcggct atgcggcgag cgtcggcaaa cgctcctatg cggcgctgct gcccgacaac       600
     gcctatggcg gcgtggtcga agccgccttc aaacaggtgg tcggcaccaa gggcggccgg       660
     atcgccgcgt tcgagaaata cggcgccgat cgcgcggctg cggcgcggac gatcgcgcag       720
     gcgcttgcgg gcgccgattc gctgctgctg gccgatgacg gcgatgcgtt ggccggggtc       780
     agcgacgccc tgacagcggc gggggtcgat ctgcgccgcc tgcaactgct cggcaccgga       840
     ttgtgggaca atccgcgggt cttcgcgacg ccggcgctac agggcgggct ctatgccgcg       900
     ccggatccgt ccggcttccg cagtttctcc ggccgctatc gcgcccgctt cggccaggac       960
     ccggtccgca ccgcgacgct cgcttacgac gcggtggcgc tggtcgccgc gctggcgcgc      1020
     acgcaagcga cgcgacggtt ttcctccgac gtgctgacca acccgtcggg cttcgccggt      1080
     atcgacggcc tgttccgctt ccgcgccgac ggcagcaatg aacgcggcct cgccgtgatg      1140
     cgcgtcgcca ccggcggcgc gcaggcggtg gccggctcac cgaagagctt cggggcttaa      1200
//

If you have problems or comments...

PBIL Back to PBIL home page