(data stored in ACNUC7421 zone)

EMBL: CP000283.PE397

CP000283.PE397       Location/Qualifiers
FT   CDS_pept        466232..467185
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0399"
FT                   /product="Protein of unknown function UPF0011"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0399"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37637"
FT                   /db_xref="GOA:Q13E52"
FT                   /db_xref="InterPro:IPR000878"
FT                   /db_xref="InterPro:IPR008189"
FT                   /db_xref="InterPro:IPR014776"
FT                   /db_xref="InterPro:IPR014777"
FT                   /db_xref="InterPro:IPR018063"
FT                   /db_xref="InterPro:IPR035996"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E52"
FT                   /protein_id="ABE37637.1"
FT                   /translation="MRAKAAPTIPSTTESEPESRAFLVAGQKLIAPRAAPGLHLVATPI
FT                   GNLGDITLRALETLAGVDVIACEDTRITHRLTERYGISAQLKPYHEHNAAQARPKILKK
FT                   LAQGGSVALVSDAGTPLISDPGYKLVREAYDAGHDVVALPGASAVLAALALAALPTDRF
FT                   FFDGFLPAKQGARRSRLSELAAIDATLVLFEAGSRIHNSLRDLAEVLGGREAAICRELT
FT                   KLHQEVRRAPLTTLAETAETLETRGEFVVVIGPPDPGARMMTQDALDTWLRDALQRDSV
FT                   KDAVAQAVDISGRPRREIYARALELARQREADDGQD"
     atgcgcgcca aagctgctcc caccataccg tcaacgaccg aatcggagcc tgaatcgcgg        60
     gcctttctgg tcgccggtca gaagctgatc gcgccgcgcg ccgctcccgg gctgcatctg       120
     gtggcgacgc cgatcggcaa tctcggcgac atcaccttgc gtgcgctgga aacattggcc       180
     ggcgtcgatg tgatcgcctg cgaagacaca cgaatcaccc atcggctgac cgaacgatac       240
     ggcatttcgg cgcagctcaa accctatcac gaacacaacg ccgcgcaggc gcgcccgaag       300
     atcctcaaga agctcgcgca aggcggctcg gtcgcgcttg tctcggacgc gggcacgccg       360
     ctgatttccg accccggcta caagctggtg cgcgaagcgt acgacgccgg acacgatgtc       420
     gtcgcgctgc ccggcgcttc cgcggtgctg gccgcgctgg cgctggccgc actgccgacc       480
     gaccgctttt tcttcgacgg ctttctgccg gccaaacagg gggcacgccg tagccggttg       540
     agcgaactcg ccgcgatcga cgcgacgctg gtgttgttcg aagcgggaag ccggattcat       600
     aacagcctgc gcgatctcgc cgaggttctc ggcgggcgcg aagccgcgat ctgccgcgaa       660
     ctcaccaagc tgcatcagga ggtgcgccgc gccccgctga cgacgttggc ggagaccgcc       720
     gaaacgctcg aaacccgcgg cgagttcgtt gtggtgatcg gtccgcccga tcccggcgcg       780
     cggatgatga cgcaggatgc gctcgatacc tggctgcgcg acgcgctgca gcgcgacagc       840
     gtcaaggacg cggtggcgca ggcggtcgac atctccgggc gtccacgccg cgaaatctac       900
     gcccgcgcgc tcgaactggc gcggcagcgc gaggccgacg atggccaaga ctag             954
//

If you have problems or comments...

PBIL Back to PBIL home page