(data stored in ACNUC7421 zone)

EMBL: CP000283.PE409

CP000283.PE409       Location/Qualifiers
FT   CDS_pept        complement(477564..478331)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0411"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisF"
FT                   /EC_number="4.1.3.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0411"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37649"
FT                   /db_xref="GOA:Q13E40"
FT                   /db_xref="InterPro:IPR004651"
FT                   /db_xref="InterPro:IPR006062"
FT                   /db_xref="InterPro:IPR011060"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13E40"
FT                   /protein_id="ABE37649.1"
FT                   /translation="MFKVRVIPCLDVKDGRVVKGVNFVDLRDAGDPVEAAIAYDAAGAD
FT                   ELCFLDITATHENRGIMLDVVRRTAEACFMPVTVGGGVRTVDDIKTLLRSGADKVSINS
FT                   AAVARREFVKEAAEKFGDQCIVVAIDAKRVPGRDRWEIFTHGGRKGTGIDAIEFAQEVV
FT                   SLGAGEILLTSMDRDGTRSGFDIPLTRAIADSVQVPVIASGGVGDLDHLVDGIREGHAT
FT                   AVLAASIFHFGEYTIREAKDHMVRAGLPMRLDP"
     atgttcaagg tccgcgtcat tccctgcctc gacgtcaagg acggccgtgt cgtcaagggc        60
     gtcaacttcg tcgatctgcg cgacgccggc gatccggtcg aggcggcgat cgcctatgac       120
     gccgccggcg cagacgagct gtgtttcctc gacatcaccg ccacgcacga aaatcgcggc       180
     atcatgctcg acgtcgtccg ccgcaccgcc gaggcctgct tcatgccggt gacggtcggc       240
     ggcggcgtgc gcaccgtcga tgatatcaag acgctgctgc gctccggggc cgacaaggtc       300
     tcgatcaatt ccgctgcggt ggcgcggcgc gaattcgtca aggaagccgc ggagaagttc       360
     ggcgaccagt gcatcgtggt ggcgatcgac gccaagcggg tgccgggccg ggatcgctgg       420
     gagatcttca cccatggcgg ccgcaagggc accggcatcg acgcaatcga atttgcgcag       480
     gaggtggtgt cgctcggcgc cggcgagatc ctgctgacct cgatggatcg cgacggcacc       540
     cgatccggtt tcgacattcc tttgacacgg gcgatcgccg acagcgtcca ggtcccggtg       600
     atcgcttcgg gcggcgtcgg cgatctcgat catctggtcg acggcattcg ggaaggccac       660
     gccaccgcgg tgctggccgc ctcgattttc catttcggcg aatacaccat tcgtgaggcc       720
     aaggatcata tggtgcgggc cggcttgccg atgcggctcg atccctag                    768
//

If you have problems or comments...

PBIL Back to PBIL home page