(data stored in ACNUC7421 zone)

EMBL: CP000283.PE411

CP000283.PE411       Location/Qualifiers
FT   CDS_pept        complement(479255..479905)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0413"
FT                   /product="imidazole glycerol phosphate synthase subunit
FT                   hisH"
FT                   /EC_number="2.4.2.-"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0413"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37651"
FT                   /db_xref="GOA:Q13E38"
FT                   /db_xref="InterPro:IPR010139"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E38"
FT                   /protein_id="ABE37651.1"
FT                   /translation="MSVAIIDYGSGNLHSAAKAFERAARSMEVPEKIIVTRDPEQVFRS
FT                   DRVVLPGVGAFADCRKGLDAVDGMVEALTETVRVKARPFFGICVGMQLMATRGKEHVTT
FT                   DGLNWIPGDVVKITPNQEELKIPHMGWNTLDVLREHPVLERLPLGPNGLHAYFVHSFHL
FT                   AAQSEGDVLARADYGGPVTAVVGRDTAIGTQFHPEKSQRFGLALISNFLKWKP"
     atgagcgtcg cgatcatcga ctatggctcc ggcaatctgc actcggccgc gaaggcgttc        60
     gagcgcgctg cgcgcagcat ggaagtgccg gaaaagatca tcgtcacccg cgatcccgaa       120
     caagtgttcc gctccgatcg ggtggtgctg ccgggcgtcg gcgccttcgc cgactgccgc       180
     aagggcctcg acgcggtcga cggcatggtc gaggcgctga ccgagacggt gcgggtcaag       240
     gcgcggccgt tcttcggcat ctgcgtcggg atgcagttga tggcgacccg cggcaaggag       300
     cacgtcacca ccgacgggct gaactggatt cccggcgacg tcgtcaagat cacgcccaac       360
     caggaagagc tgaagatccc gcatatgggc tggaatacgc tcgacgtgct gcgcgagcat       420
     ccggtgctgg agcggctgcc gcttgggccg aacggcctgc acgcctattt cgtgcattcc       480
     ttccacctcg cggcgcaaag cgagggcgat gtgctggcgc gcgccgatta tggcggaccg       540
     gtcaccgcgg tggtcggtcg cgacaccgcg atcggcaccc agtttcaccc cgagaaaagc       600
     cagcgcttcg gcctggcgct gatctcgaat tttctcaagt ggaagccgtg a                651
//

If you have problems or comments...

PBIL Back to PBIL home page