(data stored in ACNUC7421 zone)

EMBL: CP000283.PE421

CP000283.PE421       Location/Qualifiers
FT   CDS_pept        complement(487508..488203)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0423"
FT                   /product="DNA polymerase III, epsilon subunit"
FT                   /EC_number="2.7.7.7"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0423"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37661"
FT                   /db_xref="GOA:Q13E28"
FT                   /db_xref="InterPro:IPR006054"
FT                   /db_xref="InterPro:IPR006309"
FT                   /db_xref="InterPro:IPR012337"
FT                   /db_xref="InterPro:IPR013520"
FT                   /db_xref="InterPro:IPR036397"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E28"
FT                   /protein_id="ABE37661.1"
FT                   /translation="MREIVLDTETTGLDPLRGDRLVEIGCVEIYNRMPTGQAFHRYINP
FT                   ERDMPAEAFAVHGLSAEFLADKPLFAQVVDEFLDFIGDAPLVIHNASFDAGFLNAELAR
FT                   LSRAAIPRERLVDTLLLARRKHPGVSNRLDDLCSRYAIDNSRRTKHGALLDAELLAEVY
FT                   IDLIGARQSQLILAEVPSERAGQGGDKPRRQRSTPLAARVTELDLDAHRAFIATMGDKA
FT                   IWKEYPAGA"
     atgcgtgaaa tcgttctcga caccgaaacc accgggctcg atccgctgcg tggcgaccgg        60
     ctggtcgaga tcggctgcgt cgagatctac aaccggatgc cgaccgggca ggccttccac       120
     cgctacatca atccggaacg cgacatgccg gcggaagcct tcgcggtgca tgggctgtcg       180
     gccgaatttc tcgccgacaa gcctttgttc gcgcaggtcg tcgacgagtt tctcgacttc       240
     atcggcgacg cgccgctggt gatccacaac gcctcgttcg acgccggctt cctcaatgcc       300
     gaactggcgc ggctatcgcg ggccgcgatt ccgcgcgagc ggctggtcga tacgttgctg       360
     ctggcgcggc gcaagcatcc cggcgtgtcg aaccggctcg acgatctgtg ctcgcgttac       420
     gcgatcgaca attcacgccg caccaaacac ggcgcattgc tcgacgccga actgctggcg       480
     gaagtctata tcgatctgat cggcgcgcgg cagtcgcagt tgattctcgc cgaggtgccg       540
     tccgaacggg ccggccaggg cggcgataag ccccgtcggc agcggtcgac cccgctcgcg       600
     gcccgggtca ccgaactcga cctcgacgcg caccgggcgt tcatcgcgac catgggcgac       660
     aaggcgatct ggaaggaata tcccgccggc gcctga                                 696
//

If you have problems or comments...

PBIL Back to PBIL home page