(data stored in ACNUC7421 zone)

EMBL: CP000283.PE43

CP000283.PE43        Location/Qualifiers
FT   CDS_pept        55237..55872
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0043"
FT                   /product="regulatory protein, TetR"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0043"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37283"
FT                   /db_xref="GOA:Q13F56"
FT                   /db_xref="InterPro:IPR001647"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR036271"
FT                   /db_xref="InterPro:IPR041490"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F56"
FT                   /protein_id="ABE37283.1"
FT                   /translation="MIAKSRRTRTASQTRQAKPARENRAADKRPALSGDRRQALISEAA
FT                   RLFGNKGYENTSMRDIAAAVGILPGSLYHHFSSKEELFVAVYSFAVSQSVDAVTAAIEP
FT                   RSAPWIRLEAACIAHMQSLLDKSRFAAVLVSHLSVSGLPEQVVALRDSYEAVFKDLIAE
FT                   LPLPAGTDRRIFRLGLLGSMNWAITWYRPGGETPASIARKLLNAIRRD"
     atgatcgcga aaagccgacg cacccgcacc gcatcgcaaa cccgacaggc caaaccggcc        60
     cgggagaacc gcgcggccga caagcggccg gcgctttctg gcgatcgtcg acaagcgctg       120
     atcagcgagg cggcacggct gttcggcaac aagggctatg aaaacacgtc gatgcgcgac       180
     atcgccgcag cggtcggcat cctgccggga tcgctctatc atcacttttc ttccaaggaa       240
     gagttgttcg tcgccgtcta ttccttcgcc gtgtcgcaat cagtcgacgc tgtgacggca       300
     gcgatcgagc cccgatccgc cccttggatt cgcctggaag cggcttgcat cgcacacatg       360
     caaagcctgc tcgacaaaag ccgattcgcc gcggttctgg tctcgcacct atcggtgtct       420
     ggcctgccag aacaggttgt cgcgcttcgc gacagctacg aagccgtctt caaggatctg       480
     atcgcagagc tgccgctgcc ggcaggaacc gatcggcgca tcttcagact tggactgctg       540
     gggtcgatga actgggcgat cacttggtac cgccccggcg gcgagacgcc ggcgagtatc       600
     gcccggaagc tcctgaatgc gatccggcgc gattag                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page