(data stored in ACNUC7421 zone)

EMBL: CP000283.PE431

CP000283.PE431       Location/Qualifiers
FT   CDS_pept        498870..499760
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0433"
FT                   /product="chromosome segregation DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0433"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37671"
FT                   /db_xref="GOA:Q13E18"
FT                   /db_xref="InterPro:IPR003115"
FT                   /db_xref="InterPro:IPR004437"
FT                   /db_xref="InterPro:IPR036086"
FT                   /db_xref="InterPro:IPR041468"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E18"
FT                   /protein_id="ABE37671.1"
FT                   /translation="MADEHRSRLGRGLASLIGDVGGEAAHVERPRAQRKVPIEFIKANP
FT                   RNPRRTFSDAELGELSDSIRQHGVIQPIVVRPVKGAQDRFEIIAGERRWRAAQRAGLHE
FT                   VPIVPVDVSDADALEIAIVENVQREDLNPLEEAQGYHALANEFKRSQDDIAKIVGKSRS
FT                   HVANMMRLTRLPDDVLALIAAGQLSAGHARALIGVPDPSAAAKRIVAEGLNVRQTEALA
FT                   HEEGVPERKPQKPRASAAAKPAKDADTLALEKRVSDALGMKVTIEDRDGTGSLQIRYAD
FT                   LDQLDDIIRRLEAGG"
     atggccgacg agcaccgttc gcgactgggg cgcgggctgg cgagtctgat cggggatgtc        60
     ggcggcgagg ccgcgcatgt cgagcggccg cgcgcgcagc gcaaggtgcc gatcgaattc       120
     atcaaggcca atccgcgcaa cccgcgccgg acgttctccg acgccgaact cggcgaactc       180
     tccgactcga tcaggcagca tggcgtgatc cagccgatcg tggtgcggcc ggtgaaaggc       240
     gcgcaggacc ggttcgagat catcgccggc gaacggcgct ggcgcgcggc gcagcgcgcc       300
     gggctgcacg aggtgccgat cgtgccggtc gatgtcagcg acgccgatgc gctcgagatc       360
     gcgatcgtcg agaacgtaca gcgcgaggat ctcaatccgc tcgaagaggc gcagggctat       420
     cacgcgctcg ccaatgaatt caaacgcagc caggacgaca tcgcgaaaat cgtcggcaag       480
     agccgcagcc acgtcgccaa catgatgcgg ctgaccaggc tgccggacga cgtgctggcg       540
     ctgatcgccg ccggacaact atccgccggc catgcgcgcg cgctgatcgg cgtgcccgat       600
     ccgtccgccg ccgccaagcg catcgtcgcc gaaggcctca acgtccggca gaccgaagcg       660
     ctggcgcatg aagaaggcgt gccggagcgc aagccgcaga agccgcgcgc ctccgccgcc       720
     gcgaagcccg ccaaggacgc cgacacgctg gcgctggaaa aacgcgtcag cgacgcgctc       780
     ggcatgaagg tcacgatcga agaccgcgac ggcacaggct ccctgcagat ccgctacgcc       840
     gacctcgatc agctcgacga catcatccgc cggctcgagg cgggcggtta g                891
//

If you have problems or comments...

PBIL Back to PBIL home page