(data stored in ACNUC7421 zone)

EMBL: CP000283.PE441

CP000283.PE441       Location/Qualifiers
FT   CDS_pept        complement(510508..511455)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0443"
FT                   /product="outer membrane lipoprotein carrier protein LolA"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0443"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37681"
FT                   /db_xref="GOA:Q13E08"
FT                   /db_xref="InterPro:IPR004564"
FT                   /db_xref="InterPro:IPR029046"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E08"
FT                   /protein_id="ABE37681.1"
FT                   /translation="MEISERESRNRHSATVAAEGLGAGSAAPVQDITLTNDFNGLTPRP
FT                   AISTGLRRSLAAGVGLLMVTAAPLALAETVPVPRPSPKAVERQISTAEPSRPQRPPQPP
FT                   APVAKLATPPDPVIPDPRRNVPASIFTTFDAKQKADAARVSAYLSSLSTLVGNFVQVGP
FT                   DGSKLKGDFYIMKPGKVRFEYDEPSPISMVANGQSLVVRDRKLATQDIYPLSQTPLRYL
FT                   LSDRIDLLRDTSVVAITSDELYISIIIEEKNAVIGTSRLMLMLGVKDGQLKQWTVTDPQ
FT                   GYDTTVAIYNLDTARRPDPAMFKIDFTDYSTPPG"
     atggaaatct ccgagcgaga gtcgcgaaat cgccacagcg ccacggtagc cgctgagggg        60
     cttggcgccg gatccgcggc ccccgtgcag gacatcacat tgacgaacga tttcaatggt       120
     ttgacgccga ggccggcgat ctccaccggg ctccgccgga gcctcgcggc cggcgtcggc       180
     ctgctgatgg tcacggccgc gccgttggct ttggcggaga ccgtgccggt gccgaggccg       240
     tcgccgaaag cggtcgagag gcagatcagc accgccgagc cgtcccggcc gcagcgcccg       300
     ccgcaaccgc cggccccggt ggcgaagctg gccacgccgc ccgacccggt gatccccgat       360
     ccgcggcgca acgtgccggc ctcgatcttc accaccttcg acgccaagca gaaggcggac       420
     gccgcccgcg tcagcgccta tctgtcgtcg ctctcgacgc tggtcggcaa tttcgtgcag       480
     gtcggccccg acggctcgaa gctgaagggg gatttctaca tcatgaagcc gggcaaggtg       540
     cggttcgaat atgacgagcc gagcccgatc tcgatggtcg ccaacggcca gtcgctggtg       600
     gtgcgcgacc gcaagctcgc gacccaggac atctacccgc tgtcgcagac gccgctgcgc       660
     tatctgctca gcgaccgcat cgatctgttg cgcgacacca gcgtcgtcgc catcacttcg       720
     gacgagctgt acatcagcat catcatcgag gagaagaacg cggtgatcgg caccagccgg       780
     ctgatgctga tgctcggcgt caaggacggc cagctcaagc aatggaccgt caccgatccg       840
     cagggctacg acaccacggt cgcgatctac aatctcgata ccgcccggcg ccccgatccg       900
     gcgatgttta agatcgactt caccgactac tcgaccccgc cgggctag                    948
//

If you have problems or comments...

PBIL Back to PBIL home page