(data stored in ACNUC7421 zone)

EMBL: CP000283.PE448

CP000283.PE448       Location/Qualifiers
FT   CDS_pept        complement(518377..518691)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0450"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0450"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37688"
FT                   /db_xref="UniProtKB/TrEMBL:Q13E01"
FT                   /protein_id="ABE37688.1"
FT                   /translation="MMAAFVLMMSIPGLSLFYSGRQSPRPIWPPAPVRRPGARSPASAQ
FT                   SCPPAAMCKGHGDAGGVDQRPSGTAYVPLKLVGVFVALRVFREHEIKGLDISQHGEALQ
FT                   "
     atgatggccg ccttcgtgct gatgatgagc atcccgggac tctcactgtt ctactccggc        60
     aggcaatcac cgcgacccat ctggccgcct gcgccggtgc ggcgacctgg ggcgcggtcg       120
     ccggcgtcgg cacaatcatg cccgcctgcg gctatgtgca aaggtcacgg cgatgccggc       180
     ggggtggatc agcggccttc agggaccgcc tatgtgccgc tgaaactggt tggtgtgttc       240
     gtcgcgctgc gcgtatttcg cgagcacgag atcaagggtc tcgacatttc gcagcatggc       300
     gaggcgctcc aatag                                                        315
//

If you have problems or comments...

PBIL Back to PBIL home page