(data stored in ACNUC7421 zone)

EMBL: CP000283.PE457

CP000283.PE457       Location/Qualifiers
FT   CDS_pept        complement(526524..527306)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0459"
FT                   /product="histidine kinase, HAMP region"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0459"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37697"
FT                   /db_xref="GOA:Q13DZ2"
FT                   /db_xref="InterPro:IPR003660"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DZ2"
FT                   /protein_id="ABE37697.1"
FT                   /translation="MQFDLSNRNLSQKISILVLGITFFVALAIGGVGEMILHKVGADQA
FT                   KQSASVASLDRLVGLGGATLSPVRAADGSIVGMLVMQQDAGPVVMPASYEGQGLVVQAA
FT                   ETVAAPAADYALSAAHTMLLLAGIVVFAVVGLVGTRISRGLLAPLGELEKDVARLASGD
FT                   TSIRIHALSRSDEIGRIARSIAKIQESLIELARLKTQKVVGGATSVMENLKEMWGDLKS
FT                   AARNAREMLFTDGRTVGETLTRSWNDWVHNGLGVPKRA"
     atgcagttcg acctttcaaa ccggaacctg tctcagaaga tctcgatcct ggtgttggga        60
     attaccttct tcgtggcgct cgcgatcggc ggcgtcggcg agatgatttt gcataaagtg       120
     ggggcggacc aggccaagca gtcggccagc gtcgcctcgc tggaccgcct cgtcggactg       180
     ggaggcgcga cgctgtcgcc tgtccgggcg gctgacggaa gcattgtggg catgctggtg       240
     atgcaacagg acgcgggtcc cgtggtgatg ccagcgtcct atgagggtca gggccttgtg       300
     gtccaggccg cggagaccgt cgcagcgccg gctgcggatt acgcgctcag cgccgctcac       360
     accatgctgt tgctcgccgg tatcgtggtc ttcgcagtgg tcggcctggt cggcacccgg       420
     atttcccgcg gcctgctcgc tccgctgggc gaactcgaga aggacgttgc ccgtctcgcc       480
     agcggtgaca ccagcatccg cattcacgct ctgagccgct ccgacgaaat cggccggatc       540
     gcccgttcga tcgccaagat ccaggaatcg ctgatcgagc tcgccaggct gaagacccag       600
     aaggtcgtcg gcggcgcgac ctcggtgatg gagaatctca aggagatgtg gggcgatctg       660
     aaatcggctg cgcgcaacgc ccgcgagatg ctgttcacgg acggcaggac ggtcggcgag       720
     acgctgacgc ggtcatggaa cgattgggtg cataacggcc tcggcgtccc gaagcgcgcc       780
     tga                                                                     783
//

If you have problems or comments...

PBIL Back to PBIL home page