(data stored in ACNUC7421 zone)

EMBL: CP000283.PE477

CP000283.PE477       Location/Qualifiers
FT   CDS_pept        complement(553099..554922)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0479"
FT                   /product="succinate dehydrogenase subunit A"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0479"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37717"
FT                   /db_xref="GOA:Q13DX2"
FT                   /db_xref="InterPro:IPR003952"
FT                   /db_xref="InterPro:IPR003953"
FT                   /db_xref="InterPro:IPR011281"
FT                   /db_xref="InterPro:IPR014006"
FT                   /db_xref="InterPro:IPR015939"
FT                   /db_xref="InterPro:IPR027477"
FT                   /db_xref="InterPro:IPR036188"
FT                   /db_xref="InterPro:IPR037099"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX2"
FT                   /protein_id="ABE37717.1"
FT                   /translation="MAANGNGAPAVNGHAYPIEDHVYDVVVVGAGGAGLRAVVGCSEAG
FT                   LRTACITKVFPTRSHTVAAQGGISAALGNMHKDDWRWHMYDTVKGSDWLGDQDSIEYMV
FT                   RNAPEAVYELEHWGVPFSRTEEGKIYQRPFGGMTMEFGKGQAQRTCAAADRTGHAMLHT
FT                   MYGQALRHAAEFYIEFFAIDLIMDDQGCCRGVIALKLDDGTLHRFRAQTTILATGGYGR
FT                   AYASCTSAHTCTGDGGAMALRAGLPLQDMEFVQFHPTGIYGSGCLVTEGARGEGGYLVN
FT                   SEGERFMERYAPSAKDLASRDVVSRAMTIEMREGRGVGKKKDHIFLHLDHLAPEVLAER
FT                   LPGISESARIFAGVDVTREPIPILPTVHYNMGGIPTNFRGEVVTKKEGDDNAVVPGLMA
FT                   IGEAACVSVHGANRLGSNSLIDLVVFGRAAALRCAEKLTINGKQPELPADSADGTLSRL
FT                   DKYRYASGGTPTAKLRESMQQVMQNNCAVFRTGEVLSEGKDLIRKVHGGVGDIGVSDRS
FT                   LVWNSDLVETLEFDNLIIQAVVTMNSAANRTESRGAHAREDFPDRDDKQWMKHTLAWIG
FT                   DDGDTTIDYRPVHDYTMTNDVQYIPPKPRVY"
     atggcggcga acggcaacgg cgcaccggcc gtgaacggcc acgcctatcc gatcgaagac        60
     cacgtctatg atgtcgtcgt ggtcggcgcc ggcggcgcag gtttgcgcgc ggtggtgggc       120
     tgcagtgagg cggggcttcg caccgcctgc atcaccaagg tgtttccgac ccgctcccac       180
     accgtggcgg cgcagggcgg catctcggcc gcgctcggca acatgcacaa ggacgactgg       240
     cgctggcaca tgtacgacac cgtgaagggg tcggactggc tcggcgacca ggattcgatc       300
     gaatacatgg tgcgcaacgc gcccgaggcg gtctacgagc tcgaacattg gggcgtgccg       360
     ttctcgcgca ccgaagaagg caagatctat cagcgcccgt tcggcggcat gaccatggaa       420
     ttcggcaagg gccaggcgca gcgcacctgc gccgccgccg accgcaccgg ccatgcgatg       480
     ctgcacacga tgtacggcca ggcgctgcgc cacgccgccg aattctacat cgagttcttc       540
     gcgatcgacc tgatcatgga cgatcaaggc tgttgccgcg gcgtgatcgc cctgaaactc       600
     gacgacggca cgctgcatcg tttccgcgcc cagaccacca ttctggccac cggcggctac       660
     ggccgcgcct acgcctcctg cacctcggcg cacacctgca ccggcgacgg cggcgcgatg       720
     gcgctgcgcg ccggtctgcc gctgcaggac atggagttcg tccagttcca cccgaccggg       780
     atctatggtt cgggctgcct cgtcaccgag ggcgcccgcg gcgagggcgg ctatctggtc       840
     aattccgaag gcgagcgctt catggagcgc tacgcgccgt ccgccaagga tctcgcctcg       900
     cgcgacgtgg tgtcgcgcgc gatgacgatc gaaatgcgcg agggccgcgg cgtcggcaag       960
     aagaaagacc acatcttcct gcatctcgac catctcgcgc cggaagtgct ggcggagcgg      1020
     ctgccgggca tctcggaatc ggcgcggatc ttcgccggcg tcgacgtcac ccgcgagccg      1080
     atcccgatcc tgccgaccgt gcactacaac atgggcggca tcccgaccaa tttccgcggt      1140
     gaggtcgtca ccaagaagga aggcgacgac aacgccgtgg tgccgggcct gatggcgatc      1200
     ggcgaggccg cctgcgtctc cgttcacggc gccaaccgcc tcggctccaa ctcgctgatc      1260
     gacctcgtgg tgttcggccg cgccgcggcg ctgcgctgcg ccgagaagct gacgatcaac      1320
     ggcaagcagc cggagcttcc ggcggattcc gccgatggca cgctgtcgcg gctcgacaaa      1380
     tatcgctacg cctcgggcgg caccccgacc gccaagctgc gcgagagcat gcagcaggtg      1440
     atgcagaaca actgcgcggt gttccgcacc ggcgaggtgc tgagcgaggg caaggacctg      1500
     atccgcaagg tgcatggcgg cgtcggcgat atcggcgtgt ccgaccgctc gctggtgtgg      1560
     aattccgacc tggtcgagac gctggaattc gacaatctga tcatccaggc ggtggtgacg      1620
     atgaactcgg ccgccaaccg caccgagagc cgcggcgccc atgcgcgcga ggacttcccg      1680
     gatcgcgacg acaagcagtg gatgaagcac acgctggcct ggatcggcga cgacggcgac      1740
     accacgatcg attatcgccc ggttcacgac tacacgatga ccaacgacgt ccagtacatc      1800
     ccgccgaagc cgcgggtgta ttga                                             1824
//

If you have problems or comments...

PBIL Back to PBIL home page