(data stored in ACNUC7421 zone)

EMBL: CP000283.PE478

CP000283.PE478       Location/Qualifiers
FT   CDS_pept        complement(554926..555348)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0480"
FT                   /product="succinate dehydrogenase subunit D"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0480"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37718"
FT                   /db_xref="GOA:Q13DX1"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014312"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX1"
FT                   /protein_id="ABE37718.1"
FT                   /translation="MSGEESHGATRRQAASMRTPMGKVRKLGPAGSGTSDFWQQRITGV
FT                   AMTLLTLPVVVVVMMLLGRNQAGAAQILGSPLISLTMILFIIASAIHMKIGMQVVIEDY
FT                   IQNEKLKLVTVMANNFFTIAVALAAIFAIFKLASGV"
     atgagcggcg aggaatccca cggcgccacc cggcgccagg ccgcgtcgat gcgcacgccg        60
     atgggcaagg tgcgcaagct cggccctgcc ggatccggca cctctgattt ctggcagcag       120
     cgcatcaccg gcgtggcgat gaccctgctg accctgcccg tggtggtggt ggtcatgatg       180
     ctgctcggcc gcaaccaggc cggcgcggcg cagatcctcg gctcgccgct gatctcgctg       240
     accatgatcc tgttcatcat cgccagcgcg atccacatga agatcggcat gcaggtggtg       300
     atcgaggact acatccagaa cgagaagctg aagctcgtta cggtgatggc caacaatttc       360
     ttcacgatcg ccgtggcgct ggccgcgatc ttcgcgatct tcaaactcgc atccggagtg       420
     taa                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page