(data stored in ACNUC7421 zone)

EMBL: CP000283.PE479

CP000283.PE479       Location/Qualifiers
FT   CDS_pept        complement(555345..555734)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0481"
FT                   /product="succinate dehydrogenase subunit C"
FT                   /EC_number="1.3.5.1"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0481"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37719"
FT                   /db_xref="GOA:Q13DX0"
FT                   /db_xref="InterPro:IPR000701"
FT                   /db_xref="InterPro:IPR014314"
FT                   /db_xref="InterPro:IPR018495"
FT                   /db_xref="InterPro:IPR034804"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DX0"
FT                   /protein_id="ABE37719.1"
FT                   /translation="MIDRPLSPHMQAYRWSLTMALSIVHRATGIALYFGTLLLAWWLIA
FT                   CAAGPASYANLQAFTGSWIGRLILFGYTWSLMHHLLSGVRHFVWDLGYGFKTADREWLT
FT                   WAALIGGVVLTVLFWVIAFSMGVAR"
     atgatcgaca gaccgctatc tccgcacatg caggcttacc gctggagcct gacgatggcc        60
     ctgtccatcg tccatcgcgc caccggcatc gccctctatt ttggaaccct tctgctggcc       120
     tggtggctga tcgcctgcgc cgcgggacct gcctcctacg ccaatctgca ggccttcacc       180
     ggcagttgga tcggcaggct gattctgttc ggctacactt ggtcgctgat gcaccatcta       240
     ctcagcggcg tcaggcattt cgtctgggat ctcggctacg gcttcaagac cgccgaccgc       300
     gaatggctga cctgggccgc cttgatcggt ggcgtggtgc tgacggtgct gttctgggtg       360
     atcgcgttct cgatgggagt cgcacgatga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page