(data stored in ACNUC7421 zone)

EMBL: CP000283.PE48

CP000283.PE48        Location/Qualifiers
FT   CDS_pept        complement(60305..61537)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0048"
FT                   /product="ABC-type branched-chain amino acid transport
FT                   systems periplasmic component-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0048"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37288"
FT                   /db_xref="InterPro:IPR028081"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:Q13F51"
FT                   /protein_id="ABE37288.1"
FT                   /translation="MTTKMTRLLRNAALAGAALLATAAQAQDTIKVGALLPLSGNYGFL
FT                   GVTERLGIDMAVEEVNSAGGILGKKVVVVYEDAGTPAQTTRKATQMLEQDKVAFFVNGG
FT                   GSAVSATMFEFAQRNKVIDLAIDPNAEELVTTKAGKYAFLVPAPSSMIANAVIPEAIKL
FT                   GKTAMFLTHDYSFGHAQTGEQRRVLKDKGGVKEVGEIKIPLNTRDFSSQIIAIRNAKPE
FT                   MLIINVAGVDATALLEQIWEFELYKQTKIVVPLLDFEDSWAIGREKNQLIALAGIEWHY
FT                   NVPAADALAFKERYQKQFPKAEYPVPTTNTVNAYLGVRETLRAIQRAGSLDSAKIVAAL
FT                   ENHEVKDSLKPNPLVIRAKDHQWMQDFFVYKMKNPASSKELGDIYELITVAKGADIVVP
FT                   EAQRTTDLNAQ"
     atgacgacca agatgaccag actacttcgc aatgcggcgc ttgccggcgc cgcattgctg        60
     gccacggcgg cacaggcgca ggacaccatc aaggtcggcg ccttgctgcc actgagcggc       120
     aattacggct tcctcggcgt gaccgagcgc cttggtatcg acatggcggt cgaggaagtg       180
     aacagcgccg gcggcattct gggcaagaag gtcgttgtcg tttacgagga cgccggcacg       240
     cctgcgcaga ccacccgcaa ggcgacgcag atgctggagc aggacaaggt cgccttcttc       300
     gtcaatggcg gcggcagcgc ggtgagcgcg acgatgttcg aattcgcgca gcgcaacaag       360
     gtcatcgatc tggcgatcga tcccaacgcc gaagagctgg tgaccaccaa ggccggcaaa       420
     tacgcgtttc tcgtgccggc gccgagcagc atgatcgcca acgccgtgat tccggaagcg       480
     atcaagctcg gcaagaccgc gatgttcctg acgcacgact attccttcgg tcacgcccag       540
     accggcgaac agcgccgcgt gctcaaggac aagggcggcg tcaaggaggt cggcgagatc       600
     aagatcccgc tgaacacccg cgacttcagc agccagatca tcgcgatccg caacgccaaa       660
     ccggaaatgc tgatcatcaa cgtcgctggc gtcgacgcga cggcgctgct cgagcagatc       720
     tgggagttcg aactctacaa gcagaccaag atcgtggtgc cgctgctgga tttcgaggac       780
     agctgggcga tcggtcggga aaagaaccag ctgatcgcgc tggctggaat cgagtggcac       840
     tacaacgtcc cggccgctga tgcgctggca ttcaaggagc gctatcagaa gcagttcccg       900
     aaggccgaat acccggttcc gaccaccaac accgtcaacg cctatctcgg cgtgcgcgag       960
     acccttcggg cgatccagcg agccggatcg ctcgacagcg ccaagatcgt cgccgctctg      1020
     gagaaccacg aggtgaagga ttcgctgaag ccgaatccgc tggtgatccg ggccaaggac      1080
     catcagtgga tgcaggactt cttcgtctac aagatgaaga atccggcgag ctccaaggag      1140
     ctgggcgaca tctacgagct gatcaccgtc gccaaggggg ccgacatcgt cgtccccgaa      1200
     gcgcagcgca cgaccgatct caacgcgcag taa                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page