(data stored in ACNUC7421 zone)

EMBL: CP000283.PE484

CP000283.PE484       Location/Qualifiers
FT   CDS_pept        561057..561701
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0486"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0486"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37724"
FT                   /db_xref="GOA:Q13DW5"
FT                   /db_xref="InterPro:IPR000516"
FT                   /db_xref="InterPro:IPR011577"
FT                   /db_xref="InterPro:IPR016174"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DW5"
FT                   /protein_id="ABE37724.1"
FT                   /translation="MSSMTVSEQANAGQAGEETVRKVIQPAWVRIMHWINAVAMIVMIM
FT                   SGWQIYNASPLFDFQFSRSVTLGGWLGGGLLWHFAAMWVLMINGLLYLVVGLATGRFRR
FT                   KLLPITPSGVASDLAKAATFRLSHRDLTTYNYVQKLLYAGIMGVGIVVVLSGLSIWKPV
FT                   QFQLLTAVFGGYDTARYVHFFAMASIVAFLIVHIALAVLVPKSLRAMIIGR"
     atgtcgagca tgacagtcag cgaacaggcc aacgccggac aagccggcga ggagactgtg        60
     cgcaaagtga tccagccggc ctgggtgcgg atcatgcact ggatcaacgc ggtcgcgatg       120
     atcgtgatga tcatgtccgg ctggcagatc tacaacgcct cgccgttgtt cgacttccag       180
     ttttcgcgca gcgtcacgct gggcggctgg ctcggcggcg ggctgttgtg gcacttcgcg       240
     gcgatgtggg tgctgatgat caacggcctg ttgtatcttg tcgtcggtct cgccaccggt       300
     cggtttcgcc gcaagctgtt gccgatcacg ccgtcgggcg tcgcctccga tctcgccaag       360
     gccgcgacct tccggctgtc gcaccgcgat ctcaccacct acaactacgt ccagaagctg       420
     ctctatgccg gcatcatggg ggtcggcatc gtcgtcgtgc tctccgggct gtcgatctgg       480
     aagccggtgc agttccagct gctcacggcg gtgttcggcg gctacgacac cgcgcgctac       540
     gtgcatttct tcgcgatggc ttcgatcgtg gcgtttttga tcgtccatat cgcgctggcg       600
     gtactggtgc cgaagagtct tcgcgcgatg atcatcggga gataa                       645
//

If you have problems or comments...

PBIL Back to PBIL home page