(data stored in ACNUC7421 zone)

EMBL: CP000283.PE490

CP000283.PE490       Location/Qualifiers
FT   CDS_pept        complement(566522..567340)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0492"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0492"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37730"
FT                   /db_xref="GOA:Q13DV9"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV9"
FT                   /protein_id="ABE37730.1"
FT                   /translation="MRPNPALPAAPHRGRIHPALRSFADECRETVVRLLAYVGALALIG
FT                   LIVFYAANPLTDAAITAAAEPAARAGWSGAMRSHPAFAVSQIDLPGATASTEILRHPDG
FT                   GRKDILRWALAGQPPVAEITLYRPGNEARAEVQGLPDIVADIAARLDPGGGGAAQPAGL
FT                   IDSKFGTVALFDLAGRANRCFGFFKPIDEASLRISGWTCRGDSLPQRRAAAGCMLDRLV
FT                   LLSAGGDTALAETFARAELRRQGCKDGQSQQDAGADWVLGAQNPRLRGTF"
     atgcgaccga acccggccct gccggctgcg cctcatcggg gccggatcca cccggctctg        60
     cgcagcttcg ccgacgaatg ccgcgagacc gtggtgcggc tgctggccta tgtcggggcg       120
     ctggcgctga tcggcctgat cgtattctac gccgccaatc ccttgaccga cgccgcgatc       180
     accgccgccg ccgaaccggc cgcgcgggcc ggctggagcg gcgcgatgcg atcgcatccc       240
     gccttcgcgg tcagccagat cgacctgccc ggcgccaccg cgagcactga aatcctccgg       300
     catcccgatg gcggccgcaa ggacattctg cgctgggcgc ttgcggggca gccgccggtt       360
     gcggaaatca cgctctaccg gcccggcaac gaggctcgag ccgaggttca gggcttgccc       420
     gacatcgtcg ccgacatcgc tgcccggctc gatcccggcg gcggcggcgc ggcccaaccc       480
     gccggcctga tcgacagcaa attcggaacg gtggcgctgt tcgacctcgc cggtcgcgca       540
     aaccgctgct tcggcttctt caagccgatc gacgaggcgt cgctgcggat ttccggctgg       600
     acctgccggg gcgacagcct gccgcagcgc cgcgccgccg cgggctgcat gctcgaccgg       660
     ctggtgctgc tgagtgccgg cggcgacacc gcgctcgccg aaactttcgc ccgcgccgaa       720
     ctacgccgcc agggctgcaa ggacggccag agccagcagg acgccggcgc cgactgggtg       780
     ctcggcgcgc agaatccgcg actccgtggc acattctga                              819
//

If you have problems or comments...

PBIL Back to PBIL home page