(data stored in ACNUC7421 zone)

EMBL: CP000283.PE498

CP000283.PE498       Location/Qualifiers
FT   CDS_pept        574610..574948
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0500"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0500"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37738"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DV1"
FT                   /protein_id="ABE37738.1"
FT                   /translation="MIRRMTLAAAGLGLAVSLLLQAAEPAQAQTPKPARPSVSSAPADL
FT                   SPTDLSSQQRRPPRRLRIYPRNAPDGVYPRFNPGPNAVRECTATYVQEYRPSGTVITPR
FT                   MSCFWRRG"
     atgatccgac ggatgacact ggcggcggca gggctggggc tcgccgtttc gctgctgctg        60
     caggctgcgg aaccggcgca ggcgcagacc cccaaaccgg cgcggccgtc cgtctcgtcg       120
     gctcccgccg atctctcgcc gaccgacctc tcgtcgcagc agcgccgccc gccacggcga       180
     ttgcggatct atccgcgcaa cgcgccggac ggcgtctatc cgcgcttcaa tcccgggccg       240
     aacgcggtgc gcgaatgcac cgcgacctat gtccaggagt atcgcccgag cggaaccgtg       300
     atcacgccgc ggatgagttg cttctggcgc cgcggctga                              339
//

If you have problems or comments...

PBIL Back to PBIL home page