(data stored in ACNUC7421 zone)

EMBL: CP000283.PE501

CP000283.PE501       Location/Qualifiers
FT   CDS_pept        576327..577028
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0503"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0503"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37741"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU8"
FT                   /protein_id="ABE37741.1"
FT                   /translation="MAAYAMAITPRRSHPPALASRVGLFAVAAVAALAMSIATAPRAQA
FT                   LSPASAGAATANKATANNTATERLIQVRAGHIGGGGGGGHHGGGGFHGGGGFRGGGFHH
FT                   GGGFRGGGFRPAFHGGGYRGVGHIGRGPVFHHRQFYGGPRFVGHRHFGHRHFGHRYPGF
FT                   RPYYGGARYYGYSRPRYYAPVYYGPRRVCRVIYTYYGPRRVCQFRPWRHHLHRHHWRHH
FT                   HRHHRAWRVYW"
     atggccgcat acgcgatggc aatcacacca cgtcgatctc atcctcccgc tctggcaagc        60
     cgggtcggct tgttcgcggt cgcggcggtc gcggcactgg cgatgtcgat cgcgactgcg       120
     ccgcgtgcgc aggcgctgtc gccggcgagc gcgggcgcgg cgactgccaa caaggcgact       180
     gcgaacaaca cggcgaccga gcgcctgatc caggtgcgcg ccggccacat cggcggcggc       240
     ggcggtggcg gtcatcatgg cggtgggggt ttccacggcg gtggcggttt ccgcggcggc       300
     gggtttcatc atggcggggg atttcgcggc ggcggtttcc gccctgcgtt ccacggaggc       360
     ggatatcgtg gcgtcggcca tatcggtcgc gggccggtgt tccatcatcg tcagttctac       420
     ggcggcccgc gcttcgtcgg tcaccgtcac ttcggccatc gacatttcgg ccatcgatac       480
     cccggcttcc ggccgtacta cggcggcgcg cgctactacg gctattccag gccgcgctac       540
     tacgcgccgg tctactacgg gccacgtcgg gtctgccgcg tgatctacac ctattacggg       600
     ccgcgccgcg tctgccagtt ccggccgtgg cggcatcatc tgcaccgcca tcattggcgg       660
     caccatcatc gccatcaccg cgcctggcgg gtgtactggt aa                          702
//

If you have problems or comments...

PBIL Back to PBIL home page