(data stored in ACNUC7421 zone)

EMBL: CP000283.PE503

CP000283.PE503       Location/Qualifiers
FT   CDS_pept        complement(578747..579016)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0505"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0505"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37743"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DU6"
FT                   /protein_id="ABE37743.1"
FT                   /translation="MLCESAGFARAFSWCRFLLVSRARCSVVHAAPQTRDPGCFRHVQN
FT                   RGPGSAAHHVAARRVAMRPGHDCRRCCSTEPRPGHGSRYIVGRA"
     ttgctttgcg aaagcgcggg ttttgcccgc gctttttcgt ggtgtcggtt cctgcttgtg        60
     tcccgggcgc ggtgcagcgt tgttcacgct gctccgcaga cccgggaccc cggttgcttt       120
     cgccacgtcc aaaaccgggg ccccggatct gcagcgcacc acgtcgctgc gcgccgcgtt       180
     gcgatgcgtc cggggcacga ctgtcgtaga tgctgcagca cggaaccgcg ccctggccac       240
     ggcagccgat acattgtcgg ccgcgcatga                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page