(data stored in ACNUC7421 zone)

EMBL: CP000283.PE510

CP000283.PE510       Location/Qualifiers
FT   CDS_pept        complement(584490..585215)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0512"
FT                   /product="protein of unknown function DUF541"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0512"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37750"
FT                   /db_xref="InterPro:IPR007497"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT9"
FT                   /protein_id="ABE37750.1"
FT                   /translation="MTMQLHTLTAAALILATLGAAPGRAQPVPSPQQWQQQSAITVIGE
FT                   AQKSVPPDIAQVEAGVSNMAKTARAAAEANNNAMGKVLLELRNAGIDAKDIQTSRLSIQ
FT                   PQYASNRSGPSEITGYLASNLVTVHARDIARVAGLVDTLVVAGANEIRGISFRVANSSK
FT                   VLDDVRTEAIADARRKAEIYARAAGVTLGAPLVISEDASPGVAPMRKMATSFDAGAPVA
FT                   AGQETLSVTVMVSWAIKAP"
     atgaccatgc agctccacac cctcaccgcc gccgccctga tcctcgccac gctcggcgct        60
     gcgccgggtc gcgctcaacc cgtgccgtcg ccccagcaat ggcagcagca gtcggcgatc       120
     actgtcatcg gcgaagcgca gaagtcggta ccgccggaca tcgcgcaggt cgaagccggc       180
     gtttccaaca tggcgaagac ggcgcgcgcc gccgccgagg ccaacaacaa tgcgatgggc       240
     aaggtgctgc tcgagctgag aaacgccggg atcgacgcca aggacatcca gacttcgcgc       300
     ctgtcgattc agccgcaata cgcatcaaac cggtcggggc cgagcgagat cacgggctat       360
     ctcgccagca acctcgtgac cgtccatgcg cgcgacattg cccgcgtcgc cggcctggtc       420
     gacacgctgg tcgtcgccgg cgccaatgag atccgcggca tcagcttccg cgtcgccaat       480
     tcgtccaagg tgctcgacga cgtccgcacc gaggcgatcg ccgacgcccg gcgcaaggcc       540
     gagatctacg cgcgcgccgc cggcgtcacg ctcggcgcgc cgctggtgat ttccgaggac       600
     gccagcccgg gcgtcgcgcc gatgcgcaag atggcgacga gtttcgatgc cggggcgccg       660
     gtcgccgcgg gccaggaaac gctgagcgtc accgtgatgg tgagctgggc gatcaaggcc       720
     ccgtag                                                                  726
//

If you have problems or comments...

PBIL Back to PBIL home page