(data stored in ACNUC7421 zone)

EMBL: CP000283.PE515

CP000283.PE515       Location/Qualifiers
FT   CDS_pept        589326..590273
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0517"
FT                   /product="signal recognition particle-docking protein FtsY"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0517"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37755"
FT                   /db_xref="GOA:Q13DT4"
FT                   /db_xref="InterPro:IPR000897"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR004390"
FT                   /db_xref="InterPro:IPR013822"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036225"
FT                   /db_xref="InterPro:IPR042101"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT4"
FT                   /protein_id="ABE37755.1"
FT                   /translation="MSDTPETQKPSWWRRLSSGLKRTSSSIGTALSEFISKRKLDRAML
FT                   DEIEDVLLRADLGTEVASRISDAVGEGRYDKMISASDVKEIVASEVEKVLAPVAKPLVI
FT                   DDAKKPFVVLVVGVNGSGKTTTIGKLSARFAAEGRKVMMAAGDTFRAAAIEQLKVWGER
FT                   TGTPVIAGAQGSDSASLAFNALTAAKEQGRDVLLIDTAGRLQNRKELMSELEKVVRVIK
FT                   KVDDTAPHAVLLVLDATVGQNALSQVEAFTRTAGVTGLVMTKLDGTARGGILVAIAEKH
FT                   KLPVHFIGVGEGVEDLSPFTARDFAQAIAGTETQ"
     atgagtgaca ctccggaaac acagaaaccg agctggtggc ggcggctgtc cagcgggctg        60
     aagcgcacgt cgagttcgat cggcacggcg ctctccgaat tcatttccaa gcgcaaactc       120
     gaccgggcga tgctcgatga gatcgaggac gtgctgctgc gcgccgacct cggcaccgag       180
     gtggcgtcgc ggatttcgga tgcggtcggc gagggccgct acgacaagat gatttcggcg       240
     agcgatgtga aggagatcgt cgcctccgaa gtcgagaagg tgctggcgcc ggtggcgaag       300
     ccgctggtga tcgacgacgc caagaaaccg ttcgtggttc tcgtcgtcgg cgtcaacggt       360
     tcgggcaaga ccaccacgat cggcaagctg tcggcccgct tcgcggcgga aggccgcaag       420
     gtgatgatgg ccgccggcga cacgttccgc gccgcggcga tcgagcagtt gaaggtgtgg       480
     ggcgagcgca ccggcacgcc ggtgatcgcc ggcgcgcagg gctcggactc cgcgagcctc       540
     gccttcaacg cgctgaccgc ggcaaaggag cagggccgcg acgtgctgct gatcgacacc       600
     gcgggccggc tgcagaaccg caaggaactg atgagcgagc tcgaaaaggt cgttcgcgtc       660
     atcaagaagg tcgacgacac ggcgccgcat gcggtgctgc tggtgctcga cgcaactgtc       720
     ggccagaatg cgctgtcgca ggtcgaggcg ttcaccagaa ccgccggcgt caccggcctg       780
     gtgatgacca agctcgacgg caccgcgcgc ggcggcatcc tcgtggcgat cgcggagaag       840
     cacaagcttc cggtgcattt catcggcgtc ggcgaaggcg tcgaggatct ttcgccgttc       900
     accgcgcgcg atttcgcgca agcgatcgcc ggcacggaga cgcaatga                    948
//

If you have problems or comments...

PBIL Back to PBIL home page