(data stored in ACNUC7421 zone)

EMBL: CP000283.PE516

CP000283.PE516       Location/Qualifiers
FT   CDS_pept        590270..590902
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0518"
FT                   /product="intracellular septation protein A"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0518"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37756"
FT                   /db_xref="GOA:Q13DT3"
FT                   /db_xref="InterPro:IPR006008"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT3"
FT                   /protein_id="ABE37756.1"
FT                   /translation="MTKDSATNDLVPKNQPHPLFKLATELGPLLVFFFVNAKWNLFAAT
FT                   GAFMVAVIAAIIASYVVTKHVPMMALVTAVVVLVFGTLTLVLHDETFIKMKPTIVYTLF
FT                   GAVLGGGLLFGRSFIAIMFDQVFNLTAEGWRKLTLRWALFFFAMAVLNEAVWRTQTTEF
FT                   WVSFKVFGMVPLTMLFAILQMPLTKRYQVAPATLEQSATDEGDVSGR"
     atgaccaagg actccgccac caacgatctc gtgccgaaga accagccgca tccgctgttc        60
     aagctcgcga ccgagctcgg cccgctgctg gtgttcttct tcgtcaatgc gaagtggaat       120
     ctgttcgccg ccaccggcgc tttcatggtc gcggtgatcg cggccatcat cgcgtcctac       180
     gttgtcacca agcacgtgcc gatgatggct ctggtgacgg ctgtcgtcgt gctggtgttc       240
     ggcacgttga cgctggtgct gcacgacgag accttcatca agatgaagcc gaccatcgtc       300
     tacacgctgt tcggcgcggt gctcggcggc gggctgctgt tcgggcgttc gttcatcgcg       360
     atcatgttcg atcaggtgtt caacctgacg gcggaaggct ggcgcaagct gacgctgcgc       420
     tgggcgctgt tcttcttcgc gatggcggtg ttgaacgagg cggtgtggcg gacgcagacg       480
     accgagttct gggtgtcgtt caaggtgttc ggcatggtgc cgctgaccat gctgttcgcg       540
     atcctgcaga tgccgctgac caagcgctat caggttgcgc cggcgacgct ggagcaaagc       600
     gcgaccgatg aaggcgacgt ctccgggcgg tga                                    633
//

If you have problems or comments...

PBIL Back to PBIL home page