(data stored in ACNUC7421 zone)

EMBL: CP000283.PE517

CP000283.PE517       Location/Qualifiers
FT   CDS_pept        complement(591159..591551)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0519"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0519"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37757"
FT                   /db_xref="InterPro:IPR010994"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DT2"
FT                   /protein_id="ABE37757.1"
FT                   /translation="MRTFKLRTLKLRHLTLAPLAAALAFGLLVNAPAMAQAPQTTPQTD
FT                   KMAPPPAATKTSPTAGAKSEKVDLLDINSATVEQLEVLPGIGKAYSAAIIKGRPYKGKD
FT                   ELVQKKVVPEKTYEGIKDKIIAKQKG"
     atgcgtactt tcaagctgcg tactttgaag ctgcgtcatc tcacgcttgc gccgctcgcc        60
     gccgcgctcg ccttcggcct gctcgtcaac gccccggcta tggcccaggc cccccagacc       120
     acgccccaaa ccgacaagat ggcgccgccg ccggccgcga ccaagacgtc gccgaccgcc       180
     ggcgccaagt ccgagaaagt ggacctgctc gacatcaact cggccaccgt ggagcagctc       240
     gaagtgctgc cgggcatcgg caaggcctat tcggccgcga tcatcaaggg ccgcccctac       300
     aagggcaagg acgagctggt gcagaagaag gtcgtgcccg agaagaccta tgagggcatc       360
     aaggacaaga tcatcgccaa gcagaaaggc tga                                    393
//

If you have problems or comments...

PBIL Back to PBIL home page