(data stored in ACNUC7421 zone)

EMBL: CP000283.PE524

CP000283.PE524       Location/Qualifiers
FT   CDS_pept        597793..598629
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0526"
FT                   /product="protein of unknown function DUF1223"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0526"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37764"
FT                   /db_xref="InterPro:IPR010634"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS5"
FT                   /protein_id="ABE37764.1"
FT                   /translation="MQRAAFSFQGVRTAADARFVPLPAKVTMIGVVGISRWLGALGLCA
FT                   LIAMVRPAAAEPRAVVELFTSQGCSSCPPADQIIGDLSKDPSVIALSLPIDYWDYLGWK
FT                   DTLADSRFSARQRAYSQMRGDRDVYTPQVVVNGSAHVVGSNRAGIDDAIKSTDKATGVM
FT                   TVPVTMAVNDKEIKVSVAAAPPGDGERRGEVWICSVSKAVPIAITRGENRGREVTYHNV
FT                   VRTLLKVGDWTGAAGSWSVPLENIARDGIDAAAVYVQDGSRDRPGPMLGAAFTSLH"
     atgcaaaggg ccgccttttc gtttcaaggc gtccggacgg cggctgacgc ccgctttgtt        60
     ccgctcccgg caaaggtgac gatgatcggt gtagttggca tttcgcgatg gttaggcgca       120
     ctcggtctgt gcgcattgat cgcgatggtg cggcccgccg cagccgaacc gcgcgcggtg       180
     gtcgagctgt tcacctcgca gggctgttcg tcgtgtccgc cggccgatca gatcatcggc       240
     gacctgtcga aggatccgtc ggtgatcgcg ctcagcctgc cgatcgatta ctgggactat       300
     ctcggctgga aggacacgct tgcggattcg cgcttcagcg cgcgccagcg agcctattcg       360
     cagatgcggg gtgatcgcga cgtgtacacg ccgcaggtcg tcgtcaacgg ctcggcgcat       420
     gtggtcggca gcaatcgggc cggcatcgac gacgcgatca agagcaccga caaggccacc       480
     ggggtgatga cggtgccggt gacgatggcg gtcaacgaca aggagatcaa ggtgtcggtc       540
     gccgccgcgc cgccgggcga cggcgagagg cgcggcgagg tctggatctg ctcggtgtcg       600
     aaggcggtgc cgatcgcgat cacccgcggc gagaatcgcg gacgcgaggt cacttatcac       660
     aacgtcgtcc gcacgctgct caaggtcggc gactggaccg gtgcggccgg cagttggtcg       720
     gtgccgctgg aaaacatcgc gcgggacggc atcgatgccg ccgccgtcta tgtgcaggac       780
     ggcagtcgcg acaggccggg accgatgctc ggcgcggcct tcacctcgct gcactga          837
//

If you have problems or comments...

PBIL Back to PBIL home page