(data stored in ACNUC7421 zone)

EMBL: CP000283.PE528

CP000283.PE528       Location/Qualifiers
FT   CDS_pept        complement(601496..604090)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0530"
FT                   /product="protein of unknown function DUF214"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0530"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37768"
FT                   /db_xref="GOA:Q13DS1"
FT                   /db_xref="InterPro:IPR003838"
FT                   /db_xref="InterPro:IPR038766"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DS1"
FT                   /protein_id="ABE37768.1"
FT                   /translation="MTLAADPLAKSPSTSAPTSRGLSLPLRYALREMRGGLNGFYVFIA
FT                   CIALGVMAIAGVGSVAASLGDGLAREGRTLLGGDVAFSLIQREATAEELGYLRERGPVS
FT                   VAATLRGMARTAAGQSALVEIKAVDNLYPMLGELKLAPQLPTAEVLAERDGAFGAAADA
FT                   ALLARLDLKIGDRVTVGSAAFQIRSVVASEPDKLAGNVGFGPRFLISDAALRATQLLQP
FT                   GSLVRWIYRVRLPDNRADDKAAQAFADATRAALPQAGWEIRSRGNASPQLERTITRFTQ
FT                   FLTLVGLAALLVGGVGVANAVKSHIDRRRDVIAAFKALGATGHDVFAIYLTQVLVLATI
FT                   GSLIGLALGAALPFVITGLFGKLLPLPVVAALHPEELALSLVYGLLTALAFGLWPLAQV
FT                   RDVPVATLFREAATADAHRPKFRHIVWIGVVIALLLAVVIGLAYDKRVAIAFVVAAVVV
FT                   FALLRGVAAGLMAIARWLPRSRITMLRLAIANIHRPGALTPSVVLSLGLGLAVLVTISQ
FT                   IDGNLRRQFLAALPERAPTFFFIDIPSSETEQFSGFLTRIAPKATLEDVPMLRGRIVAA
FT                   RGVRAEDLKPGQDAEWVLQSDRGLTYAAEMPAGSKVVEGHWWPKDYDGKPLVSFEKKLA
FT                   DGLGLKIGDSVTVNVLGREITATISNLRSVDWQSLGINFVLVFSPNTFRGAPHTHIATL
FT                   TETGSTPESDAALIKQVADKFPMVTSVRVREALETVGGVVSNLALAVRGASSVTLISAI
FT                   LVLGGALAAGHRHRVYDAVILKTLGATRGRLIGAFALEYMMIGLATAVFGVIAGSAAAW
FT                   LIVTRLMSLSFAWQAGSAAGVVVAALVVTVGLGLVGTLLALNQKPASVLRNL"
     atgacgctgg ccgccgatcc cctcgccaag tccccatcca cgtccgcgcc gacatcgcgc        60
     ggcctgtcgc tgccgttgcg ctatgcgctg cgcgagatgc gcggcggcct caacggcttc       120
     tatgtcttca tcgcctgcat cgcgctcggc gtgatggcga tcgccggcgt cggctcggtc       180
     gccgccagtc tgggcgacgg cctcgcccgc gaaggccgca cgctgctcgg cggcgacgtc       240
     gcgttctcgc tgattcagcg cgaggccacc gccgaagagc tcggctatct gcgtgagcgc       300
     ggcccggtct cggtcgcggc gacgttgcgc ggcatggcgc gcaccgctgc gggccaatcg       360
     gcgctggtcg agatcaaggc ggtcgacaac ctctatccga tgctcggcga actgaagctc       420
     gcgccgcaac tgccgaccgc cgaggtgctg gcggagcgtg acggcgcatt cggcgccgcc       480
     gccgacgccg ccttgctggc ccggctcgat ctcaagatcg gcgaccgcgt cacggtcggc       540
     agcgccgcgt ttcaaatccg cagcgtcgtc gcctccgagc cggacaagct cgccggcaat       600
     gtcggcttcg gcccgcgctt cctgatcagc gacgcggcgc tgcgcgccac ccaattgctg       660
     cagcccggca gcctggtgcg ctggatctat cgcgtccggc tgccggacaa ccgcgccgac       720
     gacaaggccg cgcaggcttt cgccgatgcg acccgcgcgg cgctgccgca ggccggctgg       780
     gaaatccgca gccgcggcaa cgcctcgccg cagctcgagc gcaccatcac ccgtttcacc       840
     caattcctga cgctggtcgg cctcgctgcg ctgctggtcg gcggcgtcgg cgtcgccaat       900
     gcggtgaaga gccatatcga ccgccgccgc gacgtgatcg cggcgttcaa ggcgctcggc       960
     gccaccggtc acgacgtgtt cgcgatctat ctcacccagg tgctggtgct ggcgacgatc      1020
     ggctcgctga tcgggctcgc gctcggcgcc gcgctgccgt tcgtcatcac cggattgttc      1080
     ggcaagctgc tgccgctgcc ggtggtggcg gcgctgcatc ccgaggaact ggcgctgtcg      1140
     ctggtctacg gcctgctgac cgcgctcgcc ttcgggctgt ggccgctggc gcaggtgcgc      1200
     gacgtgccgg tggcgacgct gttccgcgag gccgccacgg cggacgcgca ccggccgaaa      1260
     ttccggcaca tcgtctggat cggcgtggtg atcgcgctgc tgctcgcggt ggtgatcggc      1320
     cttgcttacg acaagcgcgt cgcgatcgcc ttcgtggttg ccgcggtcgt cgtcttcgcg      1380
     ctgttgcgag gcgtcgccgc ggggctgatg gcgatcgccc gctggttgcc gcgttcgcgc      1440
     atcaccatgc tgcggctggc gatcgccaac atccatcgcc ccggcgcgct gacgccatcg      1500
     gtggtgctgt cgctgggcct gggcctcgcc gtgctggtga cgatctcgca gatcgacggc      1560
     aatctgcgtc ggcaatttct cgccgcgctg cccgagaggg cgccgacctt cttcttcatc      1620
     gacatcccgt cgagcgagac cgaacagttc agcggctttc tgacccggat cgcgccgaaa      1680
     gcgacgctgg aggacgtgcc gatgctgcgc ggccggatcg tcgccgcgcg cggcgttcgc      1740
     gccgaggatc tcaagccggg gcaggacgcc gaatgggtgc tgcagagcga ccgcggcctg      1800
     acctatgcgg ccgagatgcc ggcgggctcc aaggtcgtcg aaggccattg gtggcccaag      1860
     gattatgacg gcaagccgct ggtgtcgttc gagaagaagc tggcggacgg gctcggactg      1920
     aagatcggcg acagcgtcac cgtcaacgtg ctcggccgcg agatcacggc gacgatcagc      1980
     aatctgcgca gcgtcgactg gcagagcctc gggatcaatt tcgtgctggt gttctcgccg      2040
     aatacgttcc gtggcgcgcc acatacgcat atcgccaccc tgaccgagac cggcagcacg      2100
     ccggagagcg acgccgcttt gatcaaacag gtggcggaca aattcccgat ggtcaccagc      2160
     gtccgggtcc gcgaggcgct ggagacggtc ggcggcgttg tcagcaatct ggcgttggct      2220
     gtgcgcggcg cgagttcggt gacgctgatt tcggcgatcc tggtgctcgg cggcgcgctc      2280
     gccgcgggcc accgccatcg cgtctacgac gcggtgatcc tgaagacgct cggcgccacg      2340
     cggggccggc tgatcggcgc cttcgcgctc gaatacatga tgatcgggct cgccacggcg      2400
     gtattcggcg tgatcgccgg gtcggccgcg gcgtggctga tcgtcacacg gctgatgtcg      2460
     ttgagcttcg cctggcaggc gggctccgct gccggcgtgg tcgtcgcggc tctggtggtc      2520
     accgtcggcc tgggactggt tggaactctg ctggcgctga accagaaacc ggcttccgtt      2580
     ctgcggaatc tgtag                                                       2595
//

If you have problems or comments...

PBIL Back to PBIL home page