(data stored in ACNUC7421 zone)

EMBL: CP000283.PE530

CP000283.PE530       Location/Qualifiers
FT   CDS_pept        604899..605534
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0532"
FT                   /product="lipolytic enzyme, G-D-S-L"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0532"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37770"
FT                   /db_xref="GOA:Q13DR9"
FT                   /db_xref="InterPro:IPR008265"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR9"
FT                   /protein_id="ABE37770.1"
FT                   /translation="MVIAALAMTAMPIQRAAAQAAAKPLKVVVLGDSLSAGYGLPAEAA
FT                   FPAKLQKALQAKGIATDMINAGVSGDTASGGLQRLDWSVPPDADAVIVELGANDALRGT
FT                   DPKVPQQALDEIVKRLKARNIAVLLCGMLAPPNYGPDYAKQFNAIYPDLAGKHGVPLYR
FT                   FFLDGVAAVANLNQPDGIHPTAAGIDVVVANILPTVEAFLRSVGAQKG"
     atggttatcg cggcgttggc gatgacggcg atgccgatcc agcgcgccgc ggcgcaggcg        60
     gctgcgaagc cgctgaaggt cgtggtgctg ggcgattcgc tgtcggctgg ttatggatta       120
     ccggccgagg ccgcgtttcc ggcgaagctg cagaaagccc tgcaggccaa ggggatcgcg       180
     accgacatga tcaatgccgg ggtgtcgggc gacaccgcga gcggcgggct gcagcggctc       240
     gactggtcgg tgccgccgga cgccgatgcg gtgatcgtcg aactcggcgc caatgatgcg       300
     ctgcgcggca ccgaccccaa ggtcccccaa caggcgctgg acgagatcgt caagcgcctg       360
     aaggcgcgca acatcgcggt gctgttgtgc gggatgctgg cgccgccgaa ttacgggccg       420
     gactacgcca agcagttcaa cgcgatttat cccgatctcg ccggcaaaca cggcgtgccg       480
     ctgtatcggt ttttcctcga tggcgtcgcc gcagtcgcga acctcaatca gcccgacggc       540
     attcatccga ccgccgccgg catcgacgtc gtggtcgcga acattctgcc cacggtcgag       600
     gcatttctgc gatcggtcgg tgcgcagaag ggctga                                 636
//

If you have problems or comments...

PBIL Back to PBIL home page