(data stored in ACNUC7421 zone)

EMBL: CP000283.PE534

CP000283.PE534       Location/Qualifiers
FT   CDS_pept        608713..609912
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0536"
FT                   /product="succinyl-CoA synthetase (ADP-forming) beta
FT                   subunit"
FT                   /EC_number="6.2.1.5"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0536"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37774"
FT                   /db_xref="GOA:Q13DR5"
FT                   /db_xref="InterPro:IPR005809"
FT                   /db_xref="InterPro:IPR005811"
FT                   /db_xref="InterPro:IPR011761"
FT                   /db_xref="InterPro:IPR013650"
FT                   /db_xref="InterPro:IPR013815"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q13DR5"
FT                   /protein_id="ABE37774.1"
FT                   /translation="MNIHEYQAKAVLREFGVPVSHGYPIFKASEAEAAAKQLGGPVWVV
FT                   KSQIHAGGRGKGKFKEASAGDKGGVRLAKSIDEVKDYAQQMLHATLVTVQTGPAGKQVN
FT                   RLYVEEGSEIDKEFYLSLLVDRATSRISFVVSTEGGMSIEDVAHDTPEKIVSFTVDPAT
FT                   GIMAHHGRAVANTLGLKGEQAKQAESLVTKLYTAFLAKDMEMLEINPLVLTKQGDLKCL
FT                   DAKMSFDGNALYRHADIQALRDETEEDAKEIEASKYDLNYVTLDGTIGCMVNGAGLAMA
FT                   TMDIIKLYGMTPANFLDVGGGASKEKVTAAFKIITADPNVKGILINIFGGIMKCDIIAE
FT                   GVVAAVKEVGLDVPLVVRLEGTNVEAGKKIIKHSGLNVLPADNLDDAAQKIVNAVKQVA
FT                   "
     atgaatatcc acgaatacca agccaaagcg gtgttgcgcg agttcggcgt accggtgtcg        60
     cacggctatc cgatcttcaa ggcatccgaa gcggaggctg ccgccaagca gctcggcggt       120
     ccggtctggg tggtgaaaag ccagatccat gccggcggcc gcggcaaggg caagttcaag       180
     gaagcctccg ccggcgacaa gggcggcgtg cggctggcca agtcgatcga cgaggtcaag       240
     gactacgccc agcagatgct gcatgccacg ctggtgacgg tgcagaccgg cccggccggc       300
     aagcaggtca atcggctgta tgtcgaggaa ggctccgaga tcgacaagga gttctatctg       360
     tcgctgctgg tcgaccgcgc cacctcccgg atttccttcg tggtctcgac cgaaggcggc       420
     atgtcgatcg aagacgtcgc ccacgacacc cctgagaaga tcgtgtcgtt cacggtcgat       480
     ccggccaccg gcatcatggc gcatcacggc cgcgccgtcg ccaacacgct ggggctgaag       540
     ggcgagcagg ccaagcaggc cgaaagcctg gtgaccaagc tgtacacggc ctttttggcc       600
     aaggacatgg agatgctcga gatcaacccg ctggtgctga ccaagcaggg cgacctcaag       660
     tgcctcgacg ccaaaatgtc tttcgatggc aatgcgctgt accgccacgc cgacatccag       720
     gcgctgcgcg acgagaccga ggaagacgcc aaggaaatcg aggcgtcgaa atacgacctc       780
     aattacgtca ccctcgacgg caccatcggc tgcatggtca acggcgccgg cctcgcgatg       840
     gcgacgatgg acattatcaa gctctacggc atgacgcccg ccaacttcct cgacgtcggc       900
     ggcggcgcca gcaaggagaa ggtgaccgcg gcgttcaaga tcatcaccgc cgatccgaac       960
     gtgaagggca tcctgatcaa catcttcggc ggcatcatga agtgcgacat catcgccgag      1020
     ggcgtcgtcg ccgcggtgaa ggaagtcggc ctcgacgtgc cgctggtcgt acgcctcgaa      1080
     ggcaccaatg tcgaagccgg caagaagatc atcaagcact ccggcctcaa cgtgctgccc      1140
     gccgacaatc tcgacgacgc cgcgcagaaa attgtcaacg cagtcaagca ggtagcttga      1200
//

If you have problems or comments...

PBIL Back to PBIL home page