(data stored in ACNUC7421 zone)

EMBL: CP000283.PE536

CP000283.PE536       Location/Qualifiers
FT   CDS_pept        610186..610605
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0538"
FT                   /product="PilT protein-like"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0538"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37776"
FT                   /db_xref="GOA:Q13DR3"
FT                   /db_xref="InterPro:IPR002716"
FT                   /db_xref="InterPro:IPR022907"
FT                   /db_xref="InterPro:IPR029060"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DR3"
FT                   /protein_id="ABE37776.1"
FT                   /translation="MSAEAMLDANVLVYAASTAAAEAAKARTATQLLKTGNVGISGQVM
FT                   QEFYVTVTRKSPTPLSVDDALDWLDVFNELPCIPVDAALVRSGAEIAQRYQISYWDGAV
FT                   LAAAHRLNATVLYSEDLSHDQTYGSVRVVNPFRAN"
     atgagcgctg aagcaatgct cgacgccaac gtgctggtct acgcagcctc tacggccgcc        60
     gccgaggccg ccaaggcgcg taccgcgacg cagcttctca agacgggtaa cgtcggcatt       120
     tcggggcagg tgatgcagga attttacgtc accgttaccc gaaagagccc gacgccgtta       180
     tcggtcgacg atgccctcga ttggctcgac gtgttcaatg aattgccgtg catcccggtg       240
     gatgccgccc ttgtcagatc cggcgccgaa atcgcccaac gctatcagat ctcctactgg       300
     gatggcgccg tgctcgccgc agcccatcgt ctcaacgcca ccgtcctcta ctccgaagac       360
     ctcagccacg atcagaccta cggttcggtc cgcgtcgtga atcccttccg cgccaattaa       420
//

If you have problems or comments...

PBIL Back to PBIL home page