(data stored in ACNUC7421 zone)

EMBL: CP000283.PE541

CP000283.PE541       Location/Qualifiers
FT   CDS_pept        614527..615342
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="RPD_0543"
FT                   /product="protein of unknown function DUF6, transmembrane"
FT                   /db_xref="EnsemblGenomes-Gn:RPD_0543"
FT                   /db_xref="EnsemblGenomes-Tr:ABE37781"
FT                   /db_xref="GOA:Q13DQ8"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:Q13DQ8"
FT                   /protein_id="ABE37781.1"
FT                   /translation="MSRDLLNTVPPSQLLVIQLTASVAALAGLALPNMPWRYRSRGMLR
FT                   ASAIGILEPGLTYSIGLIGLSLTTAGSASIIGATEPIMIVLIAWLFLSQRPSPRLAVCI
FT                   VIAVIGLLMVSGETLFRPGQGNALGDGLIVLATVSAASYVVLSAKVAAHFPAATLAMAQ
FT                   QLAGLAFVFAVFVVVQAFGLERPILAELSLSIVAYAAVSGIIQYAIAFWLYLIGLRYLT
FT                   PGAAGLWLTLVPVFGIFGAFVWLDEIPTPVMLAGAALIIGAVLIGKAEK"
     atgtcgcggg atcttctgaa tacagtgccg ccgtcacagc tcctggtcat tcagctgacc        60
     gcgagcgtcg ccgcgctggc aggcctcgcc ctgccgaaca tgccgtggcg ctaccgatca       120
     cgggggatgt tgcgcgcgtc ggcgatcggc atcctggagc ccggcctgac ctattcgatc       180
     ggcctgatcg ggctgtccct gacgacggcc ggcagcgctt cgatcatcgg ggcgaccgaa       240
     ccgatcatga tcgtcttgat agcgtggctg tttctcagcc agcggccgtc gccgaggctt       300
     gcggtctgca tcgttattgc ggtgatcggc ttgctgatgg tgtccggcga gaccctcttc       360
     aggcccggac aagggaatgc gctcggagat ggcctgatcg ttttggcgac cgtctcggcc       420
     gcgagttatg tggtgctgtc ggcgaaagtg gcggctcatt ttcccgccgc gacgcttgcg       480
     atggcgcagc aactggccgg cctcgctttc gtgtttgccg tatttgtcgt cgttcaagcc       540
     tttggcctgg agcgtccgat ccttgccgag ctttcgctgt cgatcgtcgc ctatgcggcg       600
     gtgtccggaa tcattcagta tgcaatcgcg ttctggctct acctgatcgg cttgcgttat       660
     ctgaccccgg gcgccgccgg cctctggctc acgctggtcc cggtgttcgg catcttcgga       720
     gcgtttgtct ggcttgacga gattccgacg ccggtgatgc tggccggagc ggcgctgatc       780
     atcggggccg tcctcatcgg caaagccgaa aaatag                                 816
//

If you have problems or comments...

PBIL Back to PBIL home page